From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003694000
  • symbol?: nucI
  • description?: thermonuclease

      descriptions from strain specific annotations:

    • thermonuclease
    • thermonuclease (TNase) (Micrococcal nuclease)(Staphylococcal nuclease)
    • thermonuclease precursor family protein
  • strand?: +
  • coordinates?: 3998783..3999380
  • synteny block?: BlockID0027600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1160 (nuc)
    NCTC8325:
    Newman:
    NWMN_1236 (nuc)
    USA300_FPR3757:
    04-02981:
    SA2981_1279 (nuc)
    08BA02176:
    C248_1358 (nucI)
    11819-97:
    MS7_1283 (nucH)
    71193:
    ST398NM01_1326
    ECT-R 2:
    ECTR2_1183
    ED133:
    SAOV_1337 (nucI)
    ED98:
    SAAV_1303
    HO 5096 0412:
    SAEMRSA15_11710 (nucI)
    JH1:
    SaurJH1_1412
    JH9:
    SaurJH9_1385
    JKD6008:
    SAA6008_01288 (nuc)
    JKD6159:
    SAA6159_01191
    LGA251:
    SARLGA251_12330 (nucI)
    M013:
    M013TW_1272
    MRSA252:
    SAR1334 (nucI)
    MSHR1132:
    SAMSHR1132_11690
    MSSA476:
    SAS1264
    Mu3:
    SAHV_1313 (nuc)
    Mu50:
    SAV1324 (nuc)
    MW2:
    MW1211 (nuc)
    RF122:
    SAB1182 (nucI)
    ST398:
    SAPIG1326
    T0131:
    SAT0131_01393
    TCH60:
    HMPREF0772_11884 (nucI)
    TW20:
    SATW20_13260 (nucI)
    USA300_TCH1516:
    USA300HOU_1268 (nucA)
    VC40:
    SAVC_05860

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKSNKSLAMIVVAIIIVGVLAFQFMNHTGPFKKGTNHETVQDLNGKDKVHVQRVVDGDTF
    N315            MKSNKSLAMIVVAIIIVGVLAFQFMNHTGPFKKGTNHETVQDLNGKDKVHVQRVVDGDTF
    NCTC8325        MKSNKSLAMIVVAIIIVGVLAFQFMNHTGPFKKGTNHETVQDLNGKDKVHVQRVVDGDTF
    Newman          MKSNKSLAMIVVAIIIVGVLAFQFMNHTGPFKKGTNHETVQDLNGKDKVHVQRVVDGDTF
    USA300_FPR3757  MKSNKSLAMIVVAIIIVGVLAFQFMNHTGPFKKGTNHETVQDLNGKDKVHVQRVVDGDTF
                    ************************************************************

    COL             IANQNGKEIKVRLIGVDTPETVKPNTPVQPFGKEASNYSKKTLTNQDVYLEYDKEKQDRY
    N315            IANQNGKEIKVRLIGVDTPETVKPNTPVQPFGKEASNYSKKTLTNQDVYLEYDKEKQDRY
    NCTC8325        IANQNGKEIKVRLIGVDTPETVKPNTPVQPFGKEASNYSKKTLTNQDVYLEYDKEKQDRY
    Newman          IANQNGKEIKVRLIGVDTPETVKPNTPVQPFGKEASNYSKKTLTNQDVYLEYDKEKQDRY
    USA300_FPR3757  IANQNGKEIKVRLIGVDTPETVKPNTPVQPFGKEASNYSKKTLTNQDVYLEYDKEKQDRY
                    ************************************************************

    COL             GRTLAYVWISKDRMYNKELVEKGLAREKYFSPNGKYRNVFIEAQNKAKQQKLNIWSK
    N315            GRTLAYVWISKDRMYNKELVEKGLAREKYFSPNGKYRNVFIEAQNKAKQQKLNIWSK
    NCTC8325        GRTLAYVWISKDRMYNKELVEKGLAREKYFSPNGKYRNVFIEAQNKAKQQKLNIWSK
    Newman          GRTLAYVWISKDRMYNKELVEKGLAREKYFSPNGKYRNVFIEAQNKAKQQKLNIWSK
    USA300_FPR3757  GRTLAYVWISKDRMYNKELVEKGLAREKYFSPNGKYRNVFIEAQNKAKQQKLNIWSK
                    *********************************************************