From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003696000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 4000961..4001815
  • synteny block?: BlockID0027620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1280
    08BA02176:
    C248_1359
    11819-97:
    MS7_1284
    71193:
    ST398NM01_1327
    ECT-R 2:
    ECTR2_1184
    ED133:
    SAOV_1338c
    ED98:
    SAAV_1304
    HO 5096 0412:
    SAEMRSA15_11720
    JH1:
    SaurJH1_1413
    JH9:
    SaurJH9_1386
    JKD6008:
    SAA6008_01290
    JKD6159:
    SAA6159_01192
    LGA251:
    SARLGA251_12340
    M013:
    M013TW_1273
    MRSA252:
    SAR1335
    MSHR1132:
    SAMSHR1132_11700
    MSSA476:
    SAS1265
    Mu3:
    SAHV_1314
    Mu50:
    SAV1325
    MW2:
    MW1212
    RF122:
    SAB1183c
    ST398:
    SAPIG1327
    T0131:
    SAT0131_01394 (rpsR)
    TCH60:
    HMPREF0772_11883
    TW20:
    SATW20_13270
    USA300_TCH1516:
    USA300HOU_1269
    VC40:
    SAVC_05865

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSFYVVLIIIIVALIGILVLNQRYSNSKIDTEVYARKQLIKKNKALSAENAELRSQMLSS
    N315            MSFYVVLIIIIVALIGILVLNQRYSNSKIDTEVYARKQLIKKNKALSAENAELRSQMLSS
    NCTC8325        MSFYVVLIIIIVALIGILVLNQRYSNSKIDTEVYARKQLIKKNKALSAENAELRSQMLSS
    Newman          MSFYVVLIIIIVALIGILVLNQRYSNSKIDTEVYARKQLIKKNKALSAENAELRSQMLSS
    USA300_FPR3757  MSFYVVLIIIIVALIGILVLNQRYSNSKIDTEVYARKQLIKKNKALSAENAELRSQMLSS
                    ************************************************************

    COL             NNDVGHHAYKNAKRELRKILDSYLENGKLKYYDIIVTSNLATKHPFFEYARSFDFIIVSD
    N315            NNDVGHHAYKNAKRELRKILDSYLENGKLKYYDIIVTSNLATKHPFFEYARSFDFIIVSD
    NCTC8325        NNDVGHHAYKNAKRELRKILDSYLENGKLKYYDIIVTSNLATKHPFFEYARSFDFIIVSD
    Newman          NNDVGHHAYKNAKRELRKILDSYLENGKLKYYDIIVTSNLATKHPFFEYARSFDFIIVSD
    USA300_FPR3757  NNDVGHHAYKNAKRELRKILDSYLENGKLKYYDIIVTSNLATKHPFFEYARSFDFIIVSD
                    ************************************************************

    COL             IGLINVDVKSWGEKTFYHFDVPDEHDTEISNSNIEKVVGHYISQQYHDQFNSSRKSIYTF
    N315            IGLINVDVKSWGEKTFYHFDVPDEHDTEMSNSNIEKVVGHYISQQYHDQFNSSRKSIYTF
    NCTC8325        IGLINVDVKSWGEKTFYHFDVPDEHDTEISNSNIEKVVGHYISQQYHDQFNSSRKSIYTF
    Newman          IGLINVDVKSWGEKTFYHFDVPDEHDTEISNSNIEKVVGHYISQQYHDQFNSSRKSIYTF
    USA300_FPR3757  IGLINVDVKSWGEKTFYHFDVPDEHDTEISNSNIEKVVGHYISQQYHDQFNSSRKSIYTF
                    ****************************:*******************************

    COL             TETVQPNRVIYDFYDYDPYQLAANNAKALKDHIEQNFNFKVQSTGVIYFSDGTVNIIQGS
    N315            TETVQPNRVIYDFYDYDPYQLAANNAKALKDHIEQNFNFKVQSTGVIYFSDGTVNIIQGS
    NCTC8325        TETVQPNRVIYDFYDYDPYQLAANNAKALKDHIEQNFNFKVQSTGVIYFSDGTVNIIQGS
    Newman          TETVQPNRVIYDFYDYDPYQLAANNAKALKDHIEQNFNFKVQSTGVIYFSDGTVNIIQGS
    USA300_FPR3757  TETVQPNRVIYDFYDYDPYQLAANNAKALKDHIEQNFNFKVQSTGVIYFSDGTVNIIQGS
                    ************************************************************

    COL             EERDKYVDTVSTKSSLRRIISEAIELSKHPLNKEQVDQITAIFK
    N315            EERDKYVDTVSTKSSLRRIISEAIELSKHPLNKEQVDQITAIFK
    NCTC8325        EERDKYVDTVSTKSSLRRIISEAIELSKHPLNKEQVDQITAIFK
    Newman          EERDKYVDTVSTKSSLRRIISEAIELSKHPLNKEQVDQITAIFK
    USA300_FPR3757  EERDKYVDTVSTKSSLRRIISEAIELSKHPLNKEQVDQITAIFK
                    ********************************************