From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003714000
  • symbol?: lexA
  • description?: LexA repressor

      descriptions from strain specific annotations:

    • LexA repressor
    • DNA damage-inducible repressor
    • DNA damage SOS regulatory repressor protein
    • repressor LexA
    • SOS-response repressor and protease LexA
  • strand?: -
  • coordinates?: 4016613..4017236
  • synteny block?: BlockID0027800
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1374 (lexA)
    N315:
    SA1174 (lexA)
    NCTC8325:
    Newman:
    NWMN_1251 (lexA)
    USA300_FPR3757:
    04-02981:
    SA2981_1294 (lexA)
    08BA02176:
    C248_1375 (dinR)
    11819-97:
    MS7_1298 (lexA)
    71193:
    ST398NM01_1341
    ECT-R 2:
    ECTR2_1198 (lexA)
    ED133:
    SAOV_1352c (dinR)
    ED98:
    SAAV_1320 (lexA)
    HO 5096 0412:
    SAEMRSA15_11860 (dinR)
    JH1:
    SaurJH1_1427
    JH9:
    SaurJH9_1400
    JKD6008:
    SAA6008_01305 (lexA)
    JKD6159:
    SAA6159_01206 (lexA)
    LGA251:
    SARLGA251_12480 (dinR)
    M013:
    M013TW_1287
    MRSA252:
    SAR1349 (dinR)
    MSHR1132:
    SAMSHR1132_11840
    MSSA476:
    SAS1279
    Mu3:
    SAHV_1328 (lexA)
    Mu50:
    SAV1339 (lexA)
    MW2:
    MW1226 (lexA)
    RF122:
    SAB1197c (dinR)
    ST398:
    SAPIG1341 (lexA)
    T0131:
    SAT0131_01410
    TCH60:
    HMPREF0772_11869 (lexA)
    TW20:
    SATW20_13410 (dinR)
    USA300_TCH1516:
    VC40:
    SAVC_05935

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRELTKRQSEIYNYIKQVVQTKGYPPSVREIGEAVGLASSSTVHGHLSRLEEKGYIRRDP
    N315            MRELTKRQSEIYNYIKQVVQMKGYPPSVREIGEAVGLASSSTVHGHLSRLEEKGYIRRDP
    NCTC8325        MRELTKRQSEIYNYIKQVVQTKGYPPSVREIGEAVGLASSSTVHGHLSRLEEKGYIRRDP
    Newman          MRELTKRQSEIYNYIKQVVQTKGYPPSVREIGEAVGLASSFTVHGHLSRLEEKGYIEGDP
    USA300_FPR3757  MRELTKRQSEIYNYIKQVVQTKGYPPSVREIGEAVGLASSSTVHGHLSRLEEKGYIRRDP
                    ******************** ******************* ***************. **

    COL             TKPRAIEIVSDQTNDNINMEETIHVPVIGKVTAGVPITAVENIEEYFPLPEHLTSTHNSD
    N315            TKPRAIEIVSDQTNDNINMEETIHVPVIGKVTAGVPITAVENIEEYFPLPEHLTSTHNSD
    NCTC8325        TKPRAIEIVSDQTNDNINMEETIHVPVIGKVTAGVPITAVENIEEYFPLPEHLTSTHNSD
    Newman          TKPRAIEIVSDQTNDNINMEETIHVPVIGKVTAGVPITAVENIEEYFPLPEHLTSTHNSD
    USA300_FPR3757  TKPRAIEIVSDQTNDNINMEETIHVPVIGKVTAGVPITAVENIEEYFPLPEHLTSTHNSD
                    ************************************************************

    COL             IFILNVVGDSMIEAGILDGDKVIVRSQTIAENGDIIVAMTEEDEATVKRFYKEKNRYRLQ
    N315            IFILNVVGDSMIEAGILDGDKVIVRSQTIAENGDIIVAMTEEDEATVKRFYKEKNRYRLQ
    NCTC8325        IFILNVVGDSMIEAGILDGDKVIVRSQTIAENGDIIVAMTEEDEATVKRFYKEKNRYRLQ
    Newman          IFILNVVGDSMIEAGILDGDKVIVRSQTIAENGDIIVAMTEEDEATVKRFYKEKNRYRLQ
    USA300_FPR3757  IFILNVVGDSMIEAGILDGDKVIVRSQTIAENGDIIVAMTEEDEATVKRFYKEKNRYRLQ
                    ************************************************************

    COL             PENSTMEPIYLDNVAVIGKVIGLYREM
    N315            PENSTMEPIYLDNVAVIGKVIGLYREM
    NCTC8325        PENSTMEPIYLDNVAVIGKVIGLYREM
    Newman          PENSTMEPIYLDNVAVIGKVIGLYREM
    USA300_FPR3757  PENSTMEPIYLDNVAVIGKVIGLYREM
                    ***************************