From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003718000
  • symbol?:
  • description?: exported protein
  • strand?: +
  • coordinates?: 4020408..4020638
  • synteny block?: BlockID0027840
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1298
    08BA02176:
    C248_1379
    11819-97:
    MS7_1302
    71193:
    ST398NM01_1345
    ECT-R 2:
    ECTR2_1202
    ED133:
    SAOV_1356
    ED98:
    SAAV_1324
    HO 5096 0412:
    SAEMRSA15_11900
    JH1:
    SaurJH1_1431
    JH9:
    SaurJH9_1404
    JKD6008:
    SAA6008_01309
    JKD6159:
    SAA6159_01210
    LGA251:
    SARLGA251_12520
    M013:
    M013TW_1291
    MRSA252:
    SAR1353
    MSHR1132:
    SAMSHR1132_11880
    MSSA476:
    SAS1283
    Mu3:
    SAHV_1332
    Mu50:
    SAV1343
    MW2:
    MW1230
    RF122:
    SAB1201
    ST398:
    SAPIG1345
    T0131:
    SAT0131_01414 (cysG)
    TCH60:
    HMPREF0772_11865
    TW20:
    SATW20_13450
    USA300_TCH1516:
    USA300HOU_1280
    VC40:
    SAVC_05955

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----------------MATWLAIIFIVAALILGLIGGFLLARKYMMDYLKKNPPINEEML
    N315            ----------------MATWLAIIFIVAALILGLIGGFLLARKYMMDYLKKNPPINEEML
    NCTC8325        -MNLVKFSRIKKAGETMATWLAIIFIVAALILGLIGGFLLARKYMMDYLKKNPPINEEML
    Newman          MMNLVKFSRIKKAGETMATWLAIIFIVAALILGLIGGFLLARKYMMDYLKKNPPINEEML
    USA300_FPR3757  -MNLVKFSRIKKAGETMATWLAIIFIVAALILGLIGGFLLARKYMMDYLKKNPPINEEML
                                    ********************************************

    COL             RMMMMQMGQKPSQKKINQMMTMMNKNMDQNMKSAKK
    N315            RMMMMQMGQKPSQKKINQMMTMMNKNMDQNMKSAKK
    NCTC8325        RMMMMQMGQKPSQKKINQMMTMMNKNMDQNMKSAKK
    Newman          RMMMMQMGQKPSQKKINQMMTMMNKNMDQNMKSAKK
    USA300_FPR3757  RMMMMQMGQKPSQKKINQMMTMMNKNMDQNMKSAKK
                    ************************************