From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003738000
  • symbol?:
  • description?: thioesterase superfamily protein

      descriptions from strain specific annotations:

    • thioesterase superfamily protein
    • 4-hydroxybenzoyl-CoA thioesterase family active site protein
    • 4-hydroxybenzoyl-CoA thioesterase family activesite
  • strand?: +
  • coordinates?: 4035527..4035988
  • synteny block?: BlockID0028010
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1305
    08BA02176:
    C248_1387
    11819-97:
    MS7_1309
    71193:
    ST398NM01_1353
    ECT-R 2:
    ECTR2_1209
    ED133:
    SAOV_1363
    ED98:
    SAAV_1332
    HO 5096 0412:
    SAEMRSA15_11990
    JH1:
    SaurJH1_1440
    JH9:
    SaurJH9_1413
    JKD6008:
    SAA6008_01316
    JKD6159:
    SAA6159_01217
    LGA251:
    SARLGA251_12610
    M013:
    M013TW_1298
    MRSA252:
    SAR1363
    MSHR1132:
    SAMSHR1132_11950
    MSSA476:
    SAS1290
    Mu3:
    SAHV_1339
    Mu50:
    SAV1351
    MW2:
    MW1238
    RF122:
    SAB1208
    ST398:
    SAPIG1353
    T0131:
    SAT0131_01422
    TCH60:
    HMPREF0772_11858
    TW20:
    SATW20_13520
    USA300_TCH1516:
    USA300HOU_1284
    VC40:
    SAVC_06000

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIYSITEIEARYAETDKMGVIYHGNYATWFEVARLDYISKLGFSYADMEKQGIISPVTDL
    N315            MIYSITEIEARYAETDKMGVIYHGNYATWFEVARLDYISKLGFSYADMEKQGIISPVTDL
    NCTC8325        MIYSITEIEARYAETDKMGVIYHGNYATWFEVARLDYISKLGFSYADMEKQGIISPVTDL
    Newman          MIYSITEIEARYAETDKMGVIYHGNYATWFEVARLDYISKLGFSYADMEKQGIISPVTDL
    USA300_FPR3757  MIYSITEIEARYAETDKMGVIYHGNYATWFEVARLDYISKLGFSYADMEKQGIISPVTDL
                    ************************************************************

    COL             NVNYKKSIFYPEKVKVKTWVEKYSRLRSVYKYEIFNEKGELATTGSTELICIKEDTFKPI
    N315            NVNYKKSIFYPEKVKVKTWVEKYSRLRSVYKYEIFNEKGELATTGSTELICIKEDTFKPI
    NCTC8325        NVNYKKSIFYPEKVKVKTWVEKYSRLRSVYKYEIFNEKGELATTGSTELICIKEDTFKPI
    Newman          NVNYKKSIFYPEKVKVKTWVEKYSRLRSVYKYEIFNEKGELATTGSTELICIKEDTFKPI
    USA300_FPR3757  NVNYKKSIFYPEKVKVKTWVEKYSRLRSVYKYEIFNEKGELATTGSTELICIKEDTFKPI
                    ************************************************************

    COL             RLDRYFPDWHEAYSKVQTLNNEGKTVEIMDGIDSL
    N315            RLDRYFPDWHEAYSKVQTLNNEGKTVEIMDGIDSL
    NCTC8325        RLDRYFPDWHEAYSKVQTLNNEGKTVEIMDGIDSL
    Newman          RLDRYFPDWHEAYSKVQTLNNEGKTVEIMDGIDSL
    USA300_FPR3757  RLDRYFPDWHEAYSKVQTLNNEGKTVEIMDGIDSL
                    ***********************************