From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003758000
  • symbol?: tyrA
  • description?: prephenate dehydrogenase

      descriptions from strain specific annotations:

    • prephenate dehydrogenase
    • TyrAp/ACT domain, NAD-specific
    • prephenate dehydrogenase (PDH)
    • prephenate dehydrogenase family protein
    • Arogenate dehydrogenase
  • strand?: -
  • coordinates?: 4057005..4058097
  • synteny block?: BlockID0028210
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1401 (tyrA)
    N315:
    SA1197 (tyrA)
    NCTC8325:
    Newman:
    NWMN_1277 (tyrA)
    USA300_FPR3757:
    04-02981:
    SA2981_1319 (tyrA)
    08BA02176:
    C248_1403 (tyrA)
    11819-97:
    MS7_1322
    71193:
    ST398NM01_1366
    ECT-R 2:
    ECTR2_1222
    ED133:
    SAOV_1375c
    ED98:
    SAAV_1345 (tyrA)
    HO 5096 0412:
    SAEMRSA15_12130
    JH1:
    SaurJH1_1455
    JH9:
    SaurJH9_1426
    JKD6008:
    SAA6008_01330 (tyrA)
    JKD6159:
    SAA6159_01231 (tyrA)
    LGA251:
    SARLGA251_12740
    M013:
    M013TW_1311
    MRSA252:
    SAR1378
    MSHR1132:
    SAMSHR1132_12080
    MSSA476:
    SAS1305
    Mu3:
    SAHV_1353 (tyrA)
    Mu50:
    SAV1365 (tyrA)
    MW2:
    MW1252 (tyrA)
    RF122:
    SAB1220c
    ST398:
    SAPIG1366
    T0131:
    SAT0131_01437
    TCH60:
    HMPREF0772_11842 (tyrA)
    TW20:
    SATW20_13650
    USA300_TCH1516:
    USA300HOU_1300 (tyrA)
    VC40:
    SAVC_06075

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTTVLFVGLGLIGGSLASNIKYHNPNTNIIAYDADTSQLDKAKSIGIINEKCLNYSEAIK
    N315            MTTVLFVGLGLIGGSLASNIKYHNPNTNIIAYDADTSQLDKAKSIGIINEKCLNYSEAIK
    NCTC8325        MTTVLFVGLGLIGGSLASNIKYHNPNTNIIAYDADISQLDKAKSIGIINEKCLNYSEAIK
    Newman          MTTVLFVGLGLIGGSLASNIKYHNPNTNIIAYDADTSQLDKAKSIGIINEKCLNYSEAIK
    USA300_FPR3757  MTTVLFVGLGLIGGSLASNIKYHNPNTNIIAYDADTSQLDKAKSIGIINEKCLNYSEAIK
                    *********************************** ************************

    COL             KADVIIYATPVAITNKYLSELIDMPTKPGVIVSDTGSTKAMIQQHECNLLKHNIHLVSGH
    N315            KADVIIYATPVAITNKYLSELIDMPTKPGVIVSDTGSTKAMIQQHESNLLKHNIHLVSGH
    NCTC8325        KADVIIYATPVAITNKYLSELIDMPTKPGVIVSDTGSTKAMIQQHECNLLKHNIHLVSGH
    Newman          KADVIIYATPVAITNKYLSELIDMPTKPGVIVSDTGSTKAMIQQHECNLLKHNIHLVSGH
    USA300_FPR3757  KADVIIYATPVAITNKYLSELIDMPTKPGVIVSDTGSTKAMIQQHECNLLKHNIHLVSGH
                    **********************************************.*************

    COL             PMAGSHKSGVLNAKKHLFENAYYILVYNEPRNEQAANTLKELLSPTLAKFIVTTAEEHDY
    N315            PMAGSHKSGVLNAKKHLFENAYYILVYNEPRNEQAANTLKELLSPTLAKFIVTTAEEHDY
    NCTC8325        PMAGSHKSGVLNAKKHLFENAYYILVYNEPRNEQAANTLKELLSPTLAKFIVTTAEEHDY
    Newman          PMAGSHKSGVLNAKKHLFENAYYILVYNEPRNEQAANTLKELLSPTLAKFIVTTAEEHDY
    USA300_FPR3757  PMAGSHKSGVLNAKKHLFENAYYILVYNEPRNEQAANTLKELLSPTLAKFIVTTAEEHDY
                    ************************************************************

    COL             VTSVVSHLPHIVASSLVHVSQKNGQEHHLVNKLAAGGFRDITRIASSNAQMWKDITLSNK
    N315            VTSVVSHLPHIVASSLVHVSQKNGQEHHLVNKLAAGGFRDITRIASSNAQMWKDITLSNK
    NCTC8325        VTSVVSHLPHIVASSLVHVSQKNGQEHHLVNKLAAGGFRDITRIASSNAQMWKDITLSNK
    Newman          VTSVVSHLPHIVASSLVHVSQKNGQEHHLVNKLAAGGFRDITRIASSNAQMWKDITLSNK
    USA300_FPR3757  VTSVVSHLPHIVASSLVHVSQKNGQEHHLVNKLAAGGFRDITRIASSNAQMWKDITLSNK
                    ************************************************************

    COL             TYILEMIRQLKSQFQDLERLIESNDSEKLLSFFAQAKSYRDALPAKQLGGLNTAYDLYVD
    N315            TYILEMIRQLKSQFQDLERLIESNDSEKLLSFFAQAKSYRDALPAKQLGGLNTAYDLYVD
    NCTC8325        TYILEMIRQLKSQFQDLERLIESNDSEKLLSFFAQAKSYRDALPAKQLGGLNTAYDLYVD
    Newman          TYILEMIRQLKSQFQDLERLIESNDSEKLLSFFAQAKSYRDALPAKQLGGLNTAYDLYVD
    USA300_FPR3757  TYILEMIRQLKSQFQDLERLIESNDSEKLLSFFAQAKSYRDALPAKQLGGLNTAYDLYVD
                    ************************************************************

    COL             IPDESGMISKVTYILSLHNISISNLRILEVREDIYGALKISFKNPTDRERGMQALSDFDC
    N315            IPDESGMISKVTYIMSLHNISISNLRILEVREDIYGALKISFKNPTDRERGMQALSDFDC
    NCTC8325        IPDESGMISKVTYILSLHNISISNLRILEVREDIYGALKISFKNPTDRERGMQALSDFDC
    Newman          IPDESGMISKVTYILSLHNISISNLRILEVREDIYGALKISFKNPTDRERGMQALSDFDC
    USA300_FPR3757  IPDESGMISKVTYILSLHNISISNLRILEVREDIYGALKISFKNPTDRERGMQALSDFDC
                    **************:*********************************************

    COL             YIQ
    N315            YIQ
    NCTC8325        YIQ
    Newman          YIQ
    USA300_FPR3757  YIQ
                    ***