From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003762000
  • symbol?: trpE
  • description?: anthranilate synthase component I

      descriptions from strain specific annotations:

    • anthranilate synthase component I
    • Anthranilate synthase, aminase component
    • anthranilate synthase component 1
    • putative anthranilate synthase component I
    • chorismate binding protein
    • anthranilate synthase component I TrpE
    • anthranilate synthase subunit
  • strand?: +
  • coordinates?: 4059801..4061207
  • synteny block?: BlockID0028240
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1403 (trpE)
    N315:
    NCTC8325:
    Newman:
    NWMN_1279 (trpE)
    USA300_FPR3757:
    04-02981:
    SA2981_1321 (trpA)
    08BA02176:
    C248_1405 (trpE)
    11819-97:
    MS7_1324
    71193:
    ST398NM01_1368
    ECT-R 2:
    ECTR2_1224
    ED133:
    SAOV_1377
    ED98:
    SAAV_1349 (trpE)
    HO 5096 0412:
    SAEMRSA15_12150 (trpE)
    JH1:
    SaurJH1_1457
    JH9:
    SaurJH9_1428
    JKD6008:
    SAA6008_01332 (trpE)
    JKD6159:
    SAA6159_01233 (trpE)
    LGA251:
    SARLGA251_12760 (trpE)
    M013:
    M013TW_1313
    MRSA252:
    SAR1380 (trpE)
    MSHR1132:
    SAMSHR1132_12100
    MSSA476:
    SAS1307
    Mu3:
    SAHV_1355
    Mu50:
    SAV1367
    MW2:
    MW1254
    RF122:
    SAB1222 (trpE)
    ST398:
    SAPIG1368
    T0131:
    SAT0131_01439
    TCH60:
    HMPREF0772_11840 (trpE)
    TW20:
    SATW20_13670 (trpE)
    USA300_TCH1516:
    USA300HOU_1302 (trpE)
    VC40:
    SAVC_06085

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MDIFYKKIKANVTPEVLAQLHSKKIILESTNQQQTKGRYSVVIFDIYGTLTLDNDVLSVS
    N315            MDIFYKKIKANVTPEVLAQLHSKKIILESTNQQQTKGRYSVVIFDIYGTLTLDNDVLSVS
    NCTC8325        MDIFYKKIKANVTPEVLAQLHSKKIILESTNQQQTKGRYSVVIFDIYGTLTLDNDVLSVS
    Newman          MDIFYKKIKANVTPEVLAQLHSKKIILESTNQQQTKGRYSVVIFDIYGTLTLDNDVLSVS
    USA300_FPR3757  MDIFYKKIKANVTPEVLAQLHSKKIILESTNQQQTKGRYSVVIFDIYGTLTLDNDVLSVS
                    ************************************************************

    COL             TLKESYQITERPYHYLTTKINEDYHNIQDEQLKSLPFISGYVGTCSFDLVRHEFPKLQSI
    N315            TLKESYQIIERPYHYLTTKINEDYHNIQDEQLKSLPFISGYVGTCSFDLVRHEFPKLQSI
    NCTC8325        TLKESYQITERPYHYLTTKINEDYHNIQDEQLKSLPFISGYVGTCSFDLVRHEFPKLQSI
    Newman          TLKESYQITERPYHYLTTKINEDYHNIQDEQLKSLPFISGYVGTCSFDLVRHEFPKLQSI
    USA300_FPR3757  TLKESYQITERPYHYLTTKINEDYHNIQDEQLKSLPFISGYVGTCSFDLVRHEFPKLQSI
                    ******** ***************************************************

    COL             QLEDHKQHDVRLYMVEQVYVFDHYKDELYIIATNQFSNSTKSDLENRVIKSIEDLTKIQP
    N315            QLEDHKQHDVRLYMVEQVYVFDHYKDELYIIATNQFSNSTKSDLENRVNKSIEDLTKIQP
    NCTC8325        QLEDHKQHDVRLYMVEQVYVFDHYKDELYIIATNQFSNSTKSDLENRVIKSIEDLTKIQP
    Newman          QLEDHKQHDVRLYMVEQVYVFDHYKDELYIIATNQFSNSTKSDLENRVIKSIEDLTKIQP
    USA300_FPR3757  QLEDHKQHDVRLYMVEQVYVFDHYKDELYIIATNQFSNSTKSDLENRVIKSIEDLTKIQP
                    ************************************************ ***********

    COL             FMPTQDFDFKTKEIQSNISEERFIEMIQYFKEKITEGDMFQVVPSRIYKYAHHASQHLNQ
    N315            FMPTQDFDFKTKEIQSNISEERFIEMIQYFKEKITEGDMFQVVPSRIYKYAHHASQHLNQ
    NCTC8325        FMPTQDFDFKTKEIQSNISEERFIEMIQYFKEKITEGDMFQVVPSRIYKYAHHASQHLNQ
    Newman          FMPTQDFDFKTKEIQSNISEERFIEMIQYFKEKITEGDMFQVVPSRIYKYAHHASQHLNQ
    USA300_FPR3757  FMPTQDFDFKTKEIQSNISEERFIEMIQYFKEKITEGDMFQVVPSRIYKYAHHASQHLNQ
                    ************************************************************

    COL             LSFQLYQNLKRQNPSPYMYYLNIDQPYIVGSSPESFVSVKDQIVTTNPIAGTIQRGETTQ
    N315            LSFQLYQNLKRQNPSPYMYYLNIDQPYIVGSSPESFVSVKDQIVTTNPIAGTIQRGETTQ
    NCTC8325        LSFQLYQNLKRQNPSPYMYYLNIDQPYIVGSSPESFVSVKDQIVTTNPIAGTIQRGETTQ
    Newman          LSFQLYQNLKRQNPSPYMYYLNIDQPYIVGSSPESFVSVKDQIVTTNPIAGTIQRGETTQ
    USA300_FPR3757  LSFQLYQNLKRQNPSPYMYYLNIDQPYIVGSSPESFVSVKDQIVTTNPIAGTIQRGETTQ
                    ************************************************************

    COL             IDNENMKQLLNDPKECSEHRMLVDLGRNDIHRVSKIGTSKITKLMVIEKYEHVMHIVSEV
    N315            IDNENMKQLLNDPKECSEHRMLVDLGRNDIHRVSKIGTSKITKLMVIEKYEHVMHIVSEI
    NCTC8325        IDNENMKQLLNDPKECSEHRMLVDLGRNDIHRVSKIGTSKITKLMVIEKYEHVMHIVSEV
    Newman          IDNENMKQLLNDPKECSEHRMLVDLGRNDIHRVSKIGTSKITKLMVIEKYEHVMHIVSEV
    USA300_FPR3757  IDNENMKQLLNDPKECSEHRMLVDLGRNDIHRVSKIGTSKITELMVIEKYEHVMHIVSEV
                    ******************************************:****************:

    COL             TGKINQNLSPMTVIANLLPTGTVSGAPKLRAIERIYEQYPHKRGVYSGGVGYINCNHNLD
    N315            TGKINQNLSPMTVIANLLPTGTVSGAPKLRAIERIYEQYPHKRGVYSGGVGYINCNHNLD
    NCTC8325        TGKINQNLSPMTVIANLLPTGTVSGAPKLRAIERIYEQYPHKRGVYSGGVGYINCNHNLD
    Newman          TGKINQNLSPMTVIANLLPTGTVSGAPKLRAIERIYEQYPHKRGVYSGGVGYINCNHNLD
    USA300_FPR3757  TGKINQNLSPMTVIANLLPTGTVSGAPKLRAIERIYEQYPHKRGVYSGGVGYINCNHNLD
                    ************************************************************

    COL             FALAIRTMMIDEQYINVEAGCGVVYDSIPEKELNETKLKAKSLLEVSP
    N315            FALAIRTMMIDEQYINVEAGCGVVYDSIPEKELNETKLKAKSLLEVRP
    NCTC8325        FALAIRTMMIDEQYINVEAGCGVVYDSIPEKELNETKLKAKSLLEVSP
    Newman          FALAIRTMMIDEQYINVEAGCGVVYDSIPEKELNETKLKAKSLLEVSP
    USA300_FPR3757  FALAIRTMMIDEQYINVEAGCGVVYDSIPEKELNETKLKAKSLLEVSP
                    ********************************************** *