From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003765000
  • symbol?: trpC
  • description?: Indole-3-glycerol phosphate synthase

      descriptions from strain specific annotations:

    • Indole-3-glycerol phosphate synthase
    • indole-3-glycerol phosphate synthase (IGPS)
    • indole-3-glycerol phosphate synthase family protein
  • strand?: +
  • coordinates?: 4062767..4063445
  • synteny block?: BlockID0028270
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1406 (trpC)
    N315:
    SA1202 (trpC)
    NCTC8325:
    Newman:
    NWMN_1282 (trpC)
    USA300_FPR3757:
    04-02981:
    SA2981_1324 (trpC)
    08BA02176:
    C248_1408 (trpC)
    11819-97:
    MS7_1327
    71193:
    ST398NM01_1371
    ECT-R 2:
    ECTR2_1227
    ED133:
    SAOV_1380
    ED98:
    SAAV_1352 (trpC)
    HO 5096 0412:
    SAEMRSA15_12180 (trpC)
    JH1:
    SaurJH1_1460 (trpC)
    JH9:
    SaurJH9_1431 (trpC)
    JKD6008:
    SAA6008_01335 (trpC)
    JKD6159:
    SAA6159_01236 (trpC)
    LGA251:
    SARLGA251_12790 (trpC)
    M013:
    M013TW_1316
    MRSA252:
    SAR1383 (trpC)
    MSHR1132:
    SAMSHR1132_12130
    MSSA476:
    SAS1310 (trpC)
    Mu3:
    SAHV_1358 (trpC)
    Mu50:
    SAV1370 (trpC)
    MW2:
    MW1257 (trpC)
    RF122:
    SAB1225 (trpC)
    ST398:
    SAPIG1371 (trpC)
    T0131:
    SAT0131_01442
    TCH60:
    HMPREF0772_11837 (trpC)
    TW20:
    SATW20_13700 (trpC)
    USA300_TCH1516:
    USA300HOU_1305 (trpC)
    VC40:
    SAVC_06100 (trpC)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTILSEIVKYKQSLLQNGYYQDKLNTLKSVKIQNKKSFINAIEKEPKLAIIAEIKSKSPT
    N315            MTILAEIVKYKQSLLQNGYYQDKLNTLKSVKIQNKKSFINAIEKEPKLAIIAEIKSKSPT
    NCTC8325        MTILSEIVKYKQSLLQNGYYQDKLNTLKSVKIQNKKSFINAIEKEPKLAIIAEIKSKSPT
    Newman          MTILSEIVKYKQSLLQNGYYQDKLNTLKSVKIQNKKSFINAIEKEPKLAIIAEIKSKSPT
    USA300_FPR3757  MTILSEIVKYKQSLLQNGYYQDKLNTLKSVKIQNKKSFINAIEKEPKLAIIAEIKSKSPT
                    ****:*******************************************************

    COL             VNDLPERDLSQQISDYDQYGANAVSILTDEKYFSGSFERLQALTTKTTLPVLCKDFIIDP
    N315            VNDLPERDLSQQISDYEKYGANAVSILTDEKYFGGSFERLQALTTKTTLPVLCKDFIIDP
    NCTC8325        VNDLPERDLSQQISDYDQYGANAVSILTDEKYFGGSFERLQALTTKTTLPVLCKDFIIDP
    Newman          VNDLPERDLSQQISDYDQYGANAVSILTDEKYFSGSFERLQALTTKTTLPVLCKDFIIDP
    USA300_FPR3757  VNDLPERDLSQQISDYDQYGANAVSILTDEKYFGGSFERLQALTTKTTLPVLCKDFIIDP
                    ****************::***************.**************************

    COL             LQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLVEVHDRHELERAYKVNAKL
    N315            LQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLIEVHDRHELERAYKVNAKL
    NCTC8325        LQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLVEVHDRHELERAYKVNAKL
    Newman          LQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLVEVHDRHELERAYKVNAKL
    USA300_FPR3757  LQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLVEVHDRHELERAYKVNAKL
                    *****************************************:******************

    COL             IGVNNRDLKRFVTNVEHTNTILENKKTNHYYISESGIHDASDVRKILHSGIDGLLIGEAL
    N315            IGVNNRDLKRFVTNVEHTNTILENKKPNHHYISESGIHDASDVRKILHSGIDGLLIGEAL
    NCTC8325        IGVNNRDLKRFVTNVEHTNTILENKKTNHYYISESGIHDASDVRKILHSGIDGLLIGEAL
    Newman          IGVNNRDLKRFVTNVEHTNTILENKKTNHYYISESGIHDASDVRKILHSGIDGLLIGEAL
    USA300_FPR3757  IGVNNRDLKRFVTNVEHTNTILENKKTNHYYISESGIHDASDVRKILHSGIDGLLIGEAL
                    **************************.**:******************************

    COL             MRCDNLSEFLPQLKMQKVKS
    N315            MRCDNLSEFLPQLKMQKVKS
    NCTC8325        MRCDNLSEFLPQLKMQKVKS
    Newman          MRCDNLSEFLPQLKMQKVKS
    USA300_FPR3757  MRCDNLSEFLPQLKMQKVKS
                    ********************