From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003766000
  • symbol?: trpF
  • description?: N-(5'-phosphoribosyl)anthranilate isomerase

      descriptions from strain specific annotations:

    • N-(5'-phosphoribosyl)anthranilate isomerase
    • N-(5'phosphoribosyl)anthranilate (PRA)isomerase
    • Phosphoribosylanthranilate isomerase
    • transcription termination/antitermination factor NusG
    • N-(5'phosphoribosyl)anthranilate (PRA) isomerase family protein
    • N-5'-phosphoribosyl-anthranilate isomerase
  • strand?: +
  • coordinates?: 4063501..4064025
  • synteny block?: BlockID0028280
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1407 (trpF)
    N315:
    SA1203 (trpF)
    NCTC8325:
    Newman:
    NWMN_1283 (trpF)
    USA300_FPR3757:
    04-02981:
    SA2981_1325
    08BA02176:
    C248_1409 (trpF)
    11819-97:
    MS7_1328
    71193:
    ST398NM01_1372
    ECT-R 2:
    ECTR2_1228
    ED133:
    SAOV_1381
    ED98:
    SAAV_1353 (trpF)
    HO 5096 0412:
    SAEMRSA15_12190 (trpF)
    JH1:
    SaurJH1_1461
    JH9:
    SaurJH9_1432
    JKD6008:
    SAA6008_01336 (trpF)
    JKD6159:
    SAA6159_01237 (trpF)
    LGA251:
    SARLGA251_12800 (trpF)
    M013:
    M013TW_1317
    MRSA252:
    SAR1384 (trpF)
    MSHR1132:
    SAMSHR1132_12140
    MSSA476:
    SAS1311
    Mu3:
    SAHV_1359 (trpF)
    Mu50:
    SAV1371 (trpF)
    MW2:
    MW1258 (trpF)
    RF122:
    SAB1226 (trpF)
    ST398:
    SAPIG1372 (trpF)
    T0131:
    SAT0131_01443 (sbi)
    TCH60:
    HMPREF0772_11836 (trpF)
    TW20:
    SATW20_13710 (trpF)
    USA300_TCH1516:
    USA300HOU_1306 (trpF)
    VC40:
    SAVC_06105

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MMKLKFCGFTSIKDVTAASQLPIDAIGFIHYEKSKRHQTITQIKKLASAVPNHIDKVCVM
    N315            -MKLKFCGFTSIKDVTAASQLPIDAIGFIHYEKSKRHQTITQIKKLASAVPNHIDKVCVM
    NCTC8325        -MKLKFCGFTSIKDVTAASQLPIDAIGFIHYEKSKRHQTITQIKKLASAVPNHIDKVCVM
    Newman          MMKLKFCGFTSIKDVTAASQLPIDAIGFIHYEKSKRHQTITQIKKLASAVPNHIDKVCVM
    USA300_FPR3757  -MKLKFCGFTSIKDVTAASQLPIDAIGFIHYEKSKRHQTITQIKKLASAVPNHIDKVCVM
                     ***********************************************************

    COL             VNPDLTTIEHVLSNTSINTIQLHGTESIDFIQEIKKKYSSIKITKALAADENIIQNINKY
    N315            VNPDLTTIEHVLSNTSINTIQLHGTESIDFIQEIKKKYSSIKITKALAADENIIQNINKY
    NCTC8325        VNPDLTTIEHVLSNTSINTIQLHGTESIDFIQEIKKKYSSIKITKALAADENIIQNINKY
    Newman          VNPDLTTIEHVLSNTSINTIQLHGTESIDFIQEIKKKYSSIKITKALAADENIIQNINKY
    USA300_FPR3757  VNPDLTTIEHVLSNTSINTIQLHGTESIDFIQEIKKKYSSIKITKALAADENIIQNINKY
                    ************************************************************

    COL             KGFVDLFIIDTPSVSYGGTGQTYDWTILKHIKDIPYLIAGGINSENIQTVNQLKLSHQGY
    N315            KGFVDLFIIDTPSVSYGGTGQTYDWTILKHIKDIPYLIAGGINSENIQTVNQLKLSHQGY
    NCTC8325        KGFVDLFIIDTPSVSYGGTGQTYDWTILKHIKDIPYLIAGGINSENIQTVNQLKLSHQGY
    Newman          KGFVDLFIIDTPSVSYGGTGQTYDWTILKHIKDIPYLIAGGINSENIQTVNQLKLSHQGY
    USA300_FPR3757  KGFVDLFIIDTPSVSYGGTGQTYDWTILKHIKDIPYLIAGGINSENIQTVNQLKLSHQGY
                    ************************************************************

    COL             DLASGIEVNGRKDIEKMTAIVNIVKGDRDNE
    N315            DLASGIEVNGRKDIEKMTAIVNIVKGDRDNE
    NCTC8325        DLASGIEVNGRKDIEKMTAIVNIVKGDRDNE
    Newman          DLASGIEVNGRKDIEKMTAIVNIVKGDRDNE
    USA300_FPR3757  DLASGIEVNGRKDIEKMTAIVNIVKGDRDNE
                    *******************************