From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003780000
  • symbol?:
  • description?: hydrolase

      descriptions from strain specific annotations:

    • hydrolase
    • hydrolase-like protein
    • cof family hydrolase
    • cof-like hydrolase family protein
    • HAD hydrolase
    • haloacid dehalogenase-like hydrolase superfamily protein
    • hydrolase-related protein
    • pseudogene
  • strand?: +
  • coordinates?: 4076418..4077189
  • synteny block?: BlockID0028370
  • occurrence?: in 84% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1331
    08BA02176:
    C248_1414
    11819-97:
    MS7_1334
    71193:
    ST398NM01_1377
    ECT-R 2:
    ECTR2_1234
    ED133:
    ED98:
    SAAV_1359
    HO 5096 0412:
    SAEMRSA15_12410
    JH1:
    SaurJH1_1467
    JH9:
    SaurJH9_1438
    JKD6008:
    SAA6008_01341
    JKD6159:
    SAA6159_01244
    LGA251:
    M013:
    MRSA252:
    SAR1389
    MSHR1132:
    MSSA476:
    SAS1318
    Mu3:
    SAHV_1365
    Mu50:
    SAV1377
    MW2:
    MW1265
    RF122:
    ST398:
    SAPIG1377
    T0131:
    SAT0131_01448 (bioW)
    TCH60:
    HMPREF0772_11831
    TW20:
    SATW20_13760
    USA300_TCH1516:
    USA300HOU_1311
    VC40:
    SAVC_06130

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MRFVFDIDGTLCFDGRLIDQTIIDTLLQLQHDGHELIFASARPIRDLLPVLPSVFHQHTL
    N315            MRFVFDIDGTLCFDGRLIDQTIIDTLLQLQHDGHELIFASARPIRDLLPVLPSVFHQHTL
    NCTC8325        MRFVFDIDGTLCFDGRLIDQTIIDTLLQLQHDGHELIFASARPIRDLLPVLPSVFHQHTL
    Newman          MRFVFDIDGTLCFDGRLIDQTIIDTLLQLQHDGHELIFASARPIRDLLPVLPSVFHQHTL
    USA300_FPR3757  MRFVFDIDGTLCFDGRLIDQTIIDTLLQLQHDGHELIFASARPIRDLLPVLPSVFHQHTL
                    ************************************************************

    COL             IGANGAMISQQSKISVIKPIHTDTYHHIFKIIQKNELDYIIDDDWNYAAQLDAENAIFER
    N315            IGANGAMISQQSKISVIKPIHTDTYHHILKIIQKYELDYIIDDDWNYAAQLDAENAIFER
    NCTC8325        IGANGAMISQQSKISVIKPIHTDTYHHIFKIIQKYELDYIIDDDWNYAAQLDAENAIFER
    Newman          IGANGAMISQQSKISVIKPIHTDTYHHIFKIIQKYELDYIIDDDWNYAAQLDAENAIFER
    USA300_FPR3757  IGANGAMISQQSKISVIKPIHTDTYHHIFKIIQKYELDYIIDDDWNYAAQLDAENAIFER
                    ****************************:***** *************************

    COL             LDPHKLASCIDVANIDTPIKIILLNIDPAQITTILDELDKYHQELEMIHHSNEYNIDITA
    N315            LDPHKLASCIDVANIDTPIKIILLNIDPAQITTILDELNKYHQELEMIHHSNEYNIDITA
    NCTC8325        LDPHKLASCIDVANIDTPIKIILLNIDPAQITTILDELDKYHQELEMIHHSNEYNIDITA
    Newman          LDPHKLASCIDVANIDTPIKIILLNIDPAQITTILDELDKYHQELEMIHHSNEYNIDITA
    USA300_FPR3757  LDPHKLASCIDVANIDTPIKIILLNIDPAQITTILDELDKYHQELEMIHHSNEYNIDITA
                    **************************************:*********************

    COL             QNINKYTALQYIFDADVKYIAFGNDHNDIVMLQHASSGYIIGPSEAYTHAILKLDKIKHI
    N315            QNINKYTALQYIFDADVKYIAFGNDHNDIFMLQHASSGYIIGPSEAYTHAILKLDKIKHI
    NCTC8325        QNINKYTALQYIFDADVKYIAFGNDHNDIVMLQHASSGYIIGPSEAYTHAILKLDKIKHI
    Newman          QNINKYTALQYIFDADVKYIAFGNDHNDIVMLQHASSGYIIGPSEAYTHAILKLDKIKHI
    USA300_FPR3757  QNINKYTALQYIFDADVKYIAFGNDHNDIVMLQHASSGYIIGPSEAYTHAILKLDKIKHI
                    *****************************.******************************

    COL             NNNAQAICKVLKSYK
    N315            NNNTQAICKVLKSYK
    NCTC8325        NNNAQAICKVLKSYK
    Newman          NNNAQAICKVLKSYK
    USA300_FPR3757  NNNAQAICKVLKSYK
                    ***:***********