From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003786000
  • symbol?: opp-2C
  • description?: oligopeptide transporter permease

      descriptions from strain specific annotations:

    • oligopeptide transporter permease
    • binding-protein-dependent transport systems inner membrane component
    • ABC-type dipeptide/oligopeptide/nickel transport system, permease component
    • binding-protein-dependent transport system inner membrane component family protein
    • peptide ABC transporter permease
    • binding--dependent transport system inner membrane component family protein
    • oligopeptide ABC transporter membrane protein
    • putative oligopeptide transport system permease
    • oligopeptide ABC superfamily ATP binding cassette transporter, membrane protein
    • Putative oligopeptide transport system permease protein oppC2
    • oligopeptide ABC transporter permease
    • oligopeptide transporter membrane permease domain
    • nickel transport system permease protein
    • oligopeptide membrane permease
    • dipeptide/oligopeptide/nickel ABC transporter permease
  • strand?: -
  • coordinates?: 4080162..4081464
  • synteny block?: BlockID0028430
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1213 (opp-2C)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1335 (opp-2C)
    08BA02176:
    C248_1418
    11819-97:
    MS7_1338
    71193:
    ST398NM01_1381
    ECT-R 2:
    ECTR2_1238
    ED133:
    SAOV_1390c
    ED98:
    SAAV_1363
    HO 5096 0412:
    SAEMRSA15_12450
    JH1:
    SaurJH1_1471
    JH9:
    SaurJH9_1442
    JKD6008:
    SAA6008_01345 (opp-2C)
    JKD6159:
    SAA6159_01248 (opp-2C)
    LGA251:
    SARLGA251_12980
    M013:
    M013TW_1326
    MRSA252:
    SAR1394
    MSHR1132:
    SAMSHR1132_12230
    MSSA476:
    SAS1322
    Mu3:
    SAHV_1369
    Mu50:
    SAV1381
    MW2:
    MW1269 (opp-2C)
    RF122:
    SAB1236c
    ST398:
    SAPIG1381
    T0131:
    SAT0131_01452
    TCH60:
    HMPREF0772_11827
    TW20:
    SATW20_13800
    USA300_TCH1516:
    USA300HOU_1315
    VC40:
    SAVC_06150

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHKIFSKNNLIFFVFVAFIFVVIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRD
    N315            MHKIFSKNNLIFFVFVAFIFVVIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRD
    NCTC8325        MHKIFSKNNLIFFVFVAFIFVVIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRD
    Newman          MHKIFSKNNLIFFVFVAFIFVVIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRD
    USA300_FPR3757  MHKIFSKNNLIFFVFVAFIFVVIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRD
                    ************************************************************

    COL             LFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFII
    N315            LFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFII
    NCTC8325        LFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFII
    Newman          LFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFII
    USA300_FPR3757  LFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFII
                    ************************************************************

    COL             MIALASFFQPSLWNLVISITLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIR
    N315            MIALASFFQPSLWNLVISITVIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIR
    NCTC8325        MIALASFFQPSLWNLVISITLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIR
    Newman          MIALASFFQPSLWNLVISITLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIR
    USA300_FPR3757  MIALASFFQPSLWNLVISITLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIR
                    ********************:***************************************

    COL             HLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIML
    N315            HLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIML
    NCTC8325        HLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIML
    Newman          HLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIML
    USA300_FPR3757  HLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIML
                    ************************************************************

    COL             IAPASVIAITILIFNLTGDALRDRLLKQRGEYDESH
    N315            IAPASVIAITILIFNLTGDALRDRLLKQRGEYDESH
    NCTC8325        IAPASVIAITILIFNLTGDALRDRLLKQRGEYDESH
    Newman          IAPASVIAITILIFNLTGDALRDRLLKQRGEYDESH
    USA300_FPR3757  IAPASVIAITILIFNLTGDALRDRLLKQRGEYDESH
                    ************************************