From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003794000
  • symbol?: pstB
  • description?: phosphate transporter ATP-binding protein

      descriptions from strain specific annotations:

    • phosphate transporter ATP-binding protein
    • phosphate ABC transporter ATP-binding protein
    • Phosphate transport ATP-binding protein PstB
    • ABC transporter ATP-binding protein
    • Phosphate ABC superfamily ATP binding cassette transporter
    • phosphate ABC superfamily ATP binding cassette transporter, ABC protein
    • phosphate ABC transporter, ATP-binding protein
    • phosphate import ATP-binding protein
    • PstB protein
  • strand?: -
  • coordinates?: 4088030..4088881
  • synteny block?: BlockID0028510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1218 (pstB)
    NCTC8325:
    Newman:
    NWMN_1297 (pstB)
    USA300_FPR3757:
    04-02981:
    SA2981_1340 (pstB)
    08BA02176:
    C248_1425
    11819-97:
    MS7_1343 (pstB)
    71193:
    ST398NM01_1387
    ECT-R 2:
    ECTR2_1243 (pstB)
    ED133:
    SAOV_1395c
    ED98:
    SAAV_1368
    HO 5096 0412:
    SAEMRSA15_12500
    JH1:
    SaurJH1_1476
    JH9:
    SaurJH9_1447
    JKD6008:
    SAA6008_01350 (pstB)
    JKD6159:
    SAA6159_01253 (pstB)
    LGA251:
    SARLGA251_13030
    M013:
    M013TW_1331
    MRSA252:
    SAR1399
    MSHR1132:
    SAMSHR1132_12280
    MSSA476:
    SAS1327
    Mu3:
    SAHV_1374 (pstB)
    Mu50:
    SAV1386 (pstB)
    MW2:
    MW1274 (pstB)
    RF122:
    SAB1242c
    ST398:
    SAPIG1387 (pstB)
    T0131:
    SAT0131_01457
    TCH60:
    HMPREF0772_11822 (pstB)
    TW20:
    SATW20_13850
    USA300_TCH1516:
    USA300HOU_1320 (pstB)
    VC40:
    SAVC_06175

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAQTLAQTKQISQSHTFDVSQSHHKTPDDTNSHSVIYSTQNLDLWYGENHALQNINLDIY
    N315            MAQTLAQTKQISQSHTFDVSQSHHKTPDDTNSHSVIYSTQNLDLWYGENHALQNINLDIY
    NCTC8325        MAQTLAQTKQISQSHTFDVSQSHHKTPDDTNSHSVIYSTQNLDLWYGENHALQNINLDIY
    Newman          MAQTLAQTKQISQSHTFDVSQSHHKTPDDTNSHSVIYSTQNLDLWYGENHALQNINLDIY
    USA300_FPR3757  MAQTLAQTKQISQSHTFDVSQSHHKTPDDTNSHSVIYSTQNLDLWYGENHALQNINLDIY
                    ************************************************************

    COL             ENQITAIIGPSGCGKSTYIKTLNRMVELVPSVKTAGKILYRDQDIFDQKYSKEQLRTNVG
    N315            ENQITAIIGPSGCGKSTYIKTLNRMVELVPSVKTAGKILYRDQDIFDQKYSKEQLRTNVG
    NCTC8325        ENQITAIIGPSGCGKSTYIKTLNRMVELVPSVKTAGKILYRDQDIFDQKYSKEQLRTNVG
    Newman          ENQITAIIGPSGCGKSTYIKTLNRMVELVPSVKTAGKILYRDQDIFDQKYSKEQLRTNVG
    USA300_FPR3757  ENQITAIIGPSGCGKSTYIKTLNRMVELVPSVKTAGKILYRDQDIFDQKYSKEQLRTNVG
                    ************************************************************

    COL             MVFQQPNPFPKSIYDNITYGPKIHGIKNKKVLDEIVEKSLRGAAIWDELKDRLHTNAYSL
    N315            MVFQQPNPFPKSIYDNITYGPKIHGIKNKKVLDEIVEKSLRGAAIWDELKDRLHTNAYSL
    NCTC8325        MVFQQPNPFPKSIYDNITYGPKIHGIKNKKVLDEIVEKSLRGAAIWDELKDRLHTNAYSL
    Newman          MVFQQPNPFPKSIYDNITYGPKIHGIKNKKVLDEIVEKSLRGAAIWDELKDRLHTNAYSL
    USA300_FPR3757  MVFQQPNPFPKSIYDNITYGPKIHGIKNKKVLDEIVEKSLRGAAIWDELKDRLHTNAYSL
                    ************************************************************

    COL             SGGQQQRVCIARCLAIEPEVILMDEPTSALDPISTLRVEELVQELKEKYTIIMVTHNMQQ
    N315            SGGQQQRVCIARCLAIEPEVILMDEPTSALDPISTLRVEELVQELKEKYTIIMVTHNMQQ
    NCTC8325        SGGQQQRVCIARCLAIEPEVILMDEPTSALDPISTLRVEELVQELKEKYTIIMVTHNMQQ
    Newman          SGGQQQRVCIARCLAIEPEVILMDEPTSALDPISTLRVEELVQELKEKYTIIMVTHNMQQ
    USA300_FPR3757  SGGQQQRVCIARCLAIEPEVILMDEPTSALDPISTLRVEELVQELKEKYTIIMVTHNMQQ
                    ************************************************************

    COL             AARVSDKTAFFLNGYVNEYDDTDKIFSNPSNKKTEDYISGRFG
    N315            AARVSDKTAFFLNGYVNEYDDTDKIFSNPSNKKTEDYISGRFG
    NCTC8325        AARVSDKTAFFLNGYVNEYDDTDKIFSNPSNKKTEDYISGRFG
    Newman          AARVSDKTAFFLNGYVNEYDDTDKIFSNPSNKKTEDYISGRFG
    USA300_FPR3757  AARVSDKTAFFLNGYVNEYDDTDKIFSNPSNKKTEDYISGRFG
                    *******************************************