From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003803000
  • symbol?: cvfB
  • description?: S1 RNA binding domain protein

      descriptions from strain specific annotations:

    • S1 RNA binding domain protein
    • poly(U) binding protein CvfB
    • virulence factor B
    • S1 RNA binding domain-containing protein
    • conserved virulence factor B
  • strand?: -
  • coordinates?: 4093163..4094065
  • synteny block?: BlockID0028600
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1345
    08BA02176:
    C248_1430
    11819-97:
    MS7_1347 (cvfB)
    71193:
    ST398NM01_1392
    ECT-R 2:
    ECTR2_1248
    ED133:
    SAOV_1400c
    ED98:
    SAAV_1373
    HO 5096 0412:
    SAEMRSA15_12540
    JH1:
    SaurJH1_1481
    JH9:
    SaurJH9_1452
    JKD6008:
    SAA6008_01355
    JKD6159:
    SAA6159_01257
    LGA251:
    SARLGA251_13070 (cvfB)
    M013:
    M013TW_1335
    MRSA252:
    SAR1403
    MSHR1132:
    SAMSHR1132_12320
    MSSA476:
    SAS1332
    Mu3:
    SAHV_1379
    Mu50:
    SAV1391
    MW2:
    MW1279
    RF122:
    SAB1246c
    ST398:
    SAPIG1392
    T0131:
    SAT0131_01464
    TCH60:
    HMPREF0772_11818
    TW20:
    SATW20_13900 (cvfB)
    USA300_TCH1516:
    USA300HOU_1326
    VC40:
    SAVC_06200

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MALDKDIVGSIEFLEVVGLQGSTYLLKGPNGENVKLNQSEMNDDDELEVGEEYSFFIYPN
    N315            MALDKDIVGSIEFLEVVGLQGSTYLLKGPNGENVKLNQSEMNDDDELEVGEEYSFFIYPN
    NCTC8325        MALDKDIVGSIEFLEVVGLQGSTYLLKGPNGENVKLNQSEMNDDDELEVGEEYSFFIYPN
    Newman          MALDKDIVGSIEFLEVVGLQGSTYLLKGPNGENVKLNQSEMNDDDELEVGEEYSFFIYPN
    USA300_FPR3757  MALDKDIVGSIEFLEVVGLQGSTYLLKGPNGENVKLNQSEMNDDDELEVGEEYSFFIYPN
                    ************************************************************

    COL             RSGELFATQNMPDITKDKYDFAKVLKTDRDGARIDVGLPREVLVPWEDLPKVKSLWPQPG
    N315            RSGELFATQNMPDITKDKYDFAKVLKTDRDGARIDVGLPREVLVPWEDLPKVKSLWPQPG
    NCTC8325        RSGELFATQNMPDITKDKYDFAKVLKTDRDGARIDVGLPREVLVPWEDLPKVKSLWPQPG
    Newman          RSGELFATQNMPDITKDKYDFAKVLKTDRDGARIDVGLPREVLVPWEDLPKVKSLWPQPG
    USA300_FPR3757  RSGELFATQNMPDITKDKYDFAKVLKTDRDGARIDVGLPREVLVPWEDLPKVKSLWPQPG
                    ************************************************************

    COL             DYLLVTLRIDRENHMYGRLASESVVENMFTPVHDDNLKNEVIEAKPYRVLRIGSFLLSES
    N315            DHLLVTLRIDRENHMYGRLASESVVENMFTPVHDDNLKNEVIEAKPYRVLRIGSFLLSES
    NCTC8325        DYLLVTLRIDRENHMYGRLASESVVENMFTPVHDDNLKNEVIEAKPYRVLRIGSFLLSES
    Newman          DYLLVTLRIDRENHMYGRLASESVVENMFTPVHDDNLKNEVIEAKPYRVLRIGSFLLSES
    USA300_FPR3757  DYLLVTLRIDRENHMYGRLASESVVENMFTPVHDDNLKNEVIEAKPYRVLRIGSFLLSES
                    *:**********************************************************

    COL             GYKIFVHESERKAEPRLGESVQVRIIGHNDKGELNGSFLPLAHERLDDDGQVIFDLLVEY
    N315            GYKIFVHESERKAEPRLGESVQVRIIGHNDKGELNGSFLPLAHERLDDDGQVIFDLLVEY
    NCTC8325        GYKIFVHESERKAEPRLGESVQVRIIGHNDKGELNGSFLPLAHERLDDDGQVIFDLLVEY
    Newman          GYKIFVHESERKAEPRLGESVQVRIIGHNDKGELNGSFLPLAHERLDDDGQVIFDLLVEY
    USA300_FPR3757  GYKIFVHESERKAEPRLGESVQVRIIGHNDKGELNGSFLPLAHERLDDDGQVIFDLLVEY
                    ************************************************************

    COL             DGELPFWDKSSPEAIKEVFNMSKGSFKRAIGHLYKQKIINIETGKIALTKKGWSRMDSKE
    N315            DGELPFWDKSSPEAIKEVFNMSKGSFKRAIGHLYKQKIINIETGKITLTKKGWSRIDSKE
    NCTC8325        DGELPFWDKSSPEAIKEVFNMSKGSFKRAIGHLYKQKIINIETGKIALTKKGWSRMDSKE
    Newman          DGELPFWDKSSPEAIKEVFNMSKGSFKRAIGHLYKQKIINIETGKIALTKKGWSRMDSKE
    USA300_FPR3757  DGELPFWDKSSPEAIKEVFNMSKGSFKRAIGHLYKQKIINIETGKIALTKKGWSRMDSKE
                    **********************************************:********:****