From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003804000
  • symbol?:
  • description?: ABC transporter

      descriptions from strain specific annotations:

    • ABC transporter
    • ABC transporter ATP-binding protein
    • ABC transporter family protein
    • ABC superfamily ATP binding cassette transporter, binding protein
    • ATP-binding ABC transporter protein
    • ABC transporter ATP-binding protein uup
  • strand?: +
  • coordinates?: 4094191..4095813
  • synteny block?: BlockID0028610
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1346
    08BA02176:
    C248_1431
    11819-97:
    MS7_1348
    71193:
    ST398NM01_1393
    ECT-R 2:
    ECTR2_1249
    ED133:
    SAOV_1401
    ED98:
    SAAV_1374
    HO 5096 0412:
    SAEMRSA15_12550
    JH1:
    SaurJH1_1482
    JH9:
    SaurJH9_1453
    JKD6008:
    SAA6008_01356
    JKD6159:
    SAA6159_01258
    LGA251:
    SARLGA251_13080
    M013:
    M013TW_1336
    MRSA252:
    SAR1404
    MSHR1132:
    SAMSHR1132_12330
    MSSA476:
    SAS1333
    Mu3:
    SAHV_1380
    Mu50:
    SAV1392
    MW2:
    MW1280
    RF122:
    SAB1247
    ST398:
    SAPIG1393
    T0131:
    SAT0131_01465 (bioA)
    TCH60:
    HMPREF0772_11817
    TW20:
    SATW20_13910
    USA300_TCH1516:
    USA300HOU_1327
    VC40:
    SAVC_06205

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLQVTDVSLRFGDRKLFEDVNIKFTEGNCYGLIGANGAGKSTFLKILSGELDSQTGHVSL
    N315            MLQVTDVSLRFGDRKLFEDVNIKFTEGNCYGLIGANGAGKSTFLKILSGELDSQTGHVSL
    NCTC8325        MLQVTDVSLRFGDRKLFEDVNIKFTEGNCYGLIGANGAGKSTFLKILSGELDSQTGHVSL
    Newman          MLQVTDVSLRFGDRKLFEDVNIKFTEGNCYGLIGANGAGKSTFLKILSGELDSQTGHVSL
    USA300_FPR3757  MLQVTDVSLRFGDRKLFEDVNIKFTEGNCYGLIGANGAGKSTFLKILSGELDSQTGHVSL
                    ************************************************************

    COL             GKNERLAVLKQDHYAYEDERVLDVVIKGHERLYEVMKEKDEIYMKPDFSDEDGIRAAELE
    N315            GKNERLAVLKQDHYAYEDERVLDVVIKGHERLYEVMKEKDEIYMKPDFSDEDGIRAAELE
    NCTC8325        GKNERLAVLKQDHYAYEDERVLDVVIKGHERLYEVMKEKDEIYMKPDFSDEDGIRAAELE
    Newman          GKNERLAVLKQDHYAYEDERVLDVVIKGHERLYEVMKEKDEIYMKPDFSDEDGIRAAELE
    USA300_FPR3757  GKNERLAVLKQDHYAYEDERVLDVVIKGHERLYEVMKEKDEIYMKPDFSDEDGIRAAELE
                    ************************************************************

    COL             GEFAEMNGWNAEADAANLLSGLGIDPTLHDKKMAELENNQKIKVLLAQSLFGEPDVLLLD
    N315            GEFAEMNGWNAEADAANLLSGLGIDPTLHDKKMAELENNQKIKVLLAQSLFGEPDVLLLD
    NCTC8325        GEFAEMNGWNAEADAANLLSGLGIDPTLHDKKMAELENNQKIKVLLAQSLFGEPDVLLLD
    Newman          GEFAEMNGWNAEADAANLLSGLGIDPTLHDKKMAELENNQKIKVLLAQSLFGEPDVLLLD
    USA300_FPR3757  GEFAEMNGWNAEADAANLLSGLGIDPTLHDKKMAELENNQKIKVLLAQSLFGEPDVLLLD
                    ************************************************************

    COL             EPTNGLDIPAISWLEDFLINFDNTVIVVSHDRHFLNNVCTHIADLDFGKIKVYVGNYDFW
    N315            EPTNGLDIPAISWLEDFLINFDNTVIVVSHDRHFLNNVCTHIADLDFGKIKVYVGNYDFW
    NCTC8325        EPTNGLDIPAISWLEDFLINFDNTVIVVSHDRHFLNNVCTHIADLDFGKIKVYVGNYDFW
    Newman          EPTNGLDIPAISWLEDFLINFDNTVIVVSHDRHFLNNVCTHIADLDFGKIKVYVGNYDFW
    USA300_FPR3757  EPTNGLDIPAISWLEDFLINFDNTVIVVSHDRHFLNNVCTHIADLDFGKIKVYVGNYDFW
                    ************************************************************

    COL             YQSSQLAQKMAQEQNKKKEEKMKELQDFIARFSANASKSKQATSRKKQLEKIELDDIQPS
    N315            YQSSQLAQKMAQEQNKKKEEKMKELQDFIARFSANASKSKQATSRKKQLEKIELDDIQPS
    NCTC8325        YQSSQLAQKMAQEQNKKKEEKMKELQDFIARFSANASKSKQATSRKKQLEKIELDDIQPS
    Newman          YQSSQLAQKMAQEQNKKKEEKMKELQDFIARFSANASKSKQATSRKKQLEKIELDDIQPS
    USA300_FPR3757  YQSSQLAQKMAQEQNKKKEEKMKELQDFIARFSANASKSKQATSRKKQLEKIELDDIQPS
                    ************************************************************

    COL             SRRYPFVKFTPEREIGNDLLIVQNLSKTIDGEKVLDNISFTMNPNDKAILIGDSEIAKTT
    N315            SRRYPFVKFTPEREIGNDLLIVQNLSKTIDGEKVLDNVSFTMNPNDKAILIGDSEIAKTT
    NCTC8325        SRRYPFVKFTPEREIGNDLLIVQNLSKTIDGEKVLDNISFTMNPNDKAILIGDSEIAKTT
    Newman          SRRYPFVKFTPEREIGNDLLIVQNLSKTIDGEKVLDNISFTMNPNDKAILIGDSEIAKTT
    USA300_FPR3757  SRRYPFVKFTPEREIGNDLLIVQNLSKTIDGEKVLDNISFTMNPNDKAILIGDSEIAKTT
                    *************************************:**********************

    COL             LLKILAGEMEPDEGSYKWGVTTSLSYFPKDNSEFFEGVNMNLVDWLRQYAPEDEQTETFL
    N315            LLKILAGEMEPDEGSFKWGVTTSLSYFPKDNSEFFEGVNMNLVDWLRQYAPEDEQTETFL
    NCTC8325        LLKILAGEMEPDEGSYKWGVTTSLSYFPKDNSEFFEGVNMNLVDWLRQYAPEDEQTETFL
    Newman          LLKILAGEMEPDEGSYKWGVTTSLSYFPKDNSEFFEGVNMNLVDWLRQYAPEDEQTETFL
    USA300_FPR3757  LLKILAGEMEPDEGSYKWGVTTSLSYFPKDNSEFFEGVNMNLVDWLRQYAPEDEQTETFL
                    ***************:********************************************

    COL             RGFLGRMLFSGEEVKKKASVLSGGEKVRCMLSKMMLSSANVLLLDEPTNHLDLESITAVN
    N315            RGFLGRMLFSGEEVKKKASVLSGGEKVRCMLSKMMLSSANVLLLDEPTNHLDLESITAVN
    NCTC8325        RGFLGRMLFSGEEVKKKASVLSGGEKVRCMLSKMMLSSANVLLLDEPTNHLDLESITAVN
    Newman          RGFLGRMLFSGEEVKKKASVLSGGEKVRCMLSKMMLSSANVLLLDEPTNHLDLESITAVN
    USA300_FPR3757  RGFLGRMLFSGEEVKKKASVLSGGEKVRCMLSKMMLSSANVLLLDEPTNHLDLESITAVN
                    ************************************************************

    COL             DGLKSFKGSIIFTSYDFEFINTIANRVIDLNKQGGVSKEIPYEEYLQEIGVLK
    N315            DGLKSFKGSIIFTSYDFEFINTIANRVIDLNKQGGVSKEIPYEEYLQEIGVLK
    NCTC8325        DGLKSFKGSIIFTSYDFEFINTIANRVIDLNKQGGVSKEIPYEEYLQEIGVLK
    Newman          DGLKSFKGSIIFTSYDFEFINTIANRVIDLNKQGGVSKEIPYEEYLQEIGVLK
    USA300_FPR3757  DGLKSFKGSIIFTSYDFEFINTIANRVIDLNKQGGVSKEIPYEEYLQEIGVLK
                    *****************************************************