From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003810000
  • symbol?: dapD
  • description?: tetrahydrodipicolinate acetyltransferase

      descriptions from strain specific annotations:

    • tetrahydrodipicolinate acetyltransferase
    • tetrahydrodipicolinate succinyltransferase domain-containing protein
    • 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
    • 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase
    • transferase hexapeptide (three repeats) family protein
    • 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
    • putative tetrahydrodipicolinateacetyltransferase
    • tetrahydrodipicolinate N-acetyltransferase
    • 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
  • strand?: +
  • coordinates?: 4101074..4101793
  • synteny block?: BlockID0028670
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1432 (dapD)
    N315:
    SA1229 (dapD)
    NCTC8325:
    Newman:
    NWMN_1308 (dapD)
    USA300_FPR3757:
    04-02981:
    SA2981_1351 (dapD)
    08BA02176:
    C248_1436 (dapD)
    11819-97:
    MS7_1353 (dapD)
    71193:
    ST398NM01_1398
    ECT-R 2:
    ECTR2_1254
    ED133:
    SAOV_1406 (dapD)
    ED98:
    SAAV_1380 (dapD)
    HO 5096 0412:
    SAEMRSA15_12600 (dapD)
    JH1:
    SaurJH1_1487
    JH9:
    SaurJH9_1458
    JKD6008:
    SAA6008_01361 (dapD)
    JKD6159:
    SAA6159_01263 (dapD)
    LGA251:
    SARLGA251_13130 (dapD)
    M013:
    M013TW_1341
    MRSA252:
    SAR1409 (dapD)
    MSHR1132:
    SAMSHR1132_12380
    MSSA476:
    SAS1338
    Mu3:
    SAHV_1385 (dapD)
    Mu50:
    SAV1397 (dapD)
    MW2:
    MW1285 (dapD)
    RF122:
    SAB1252 (dapD)
    ST398:
    SAPIG1398
    T0131:
    SAT0131_01472
    TCH60:
    HMPREF0772_11812 (dapD)
    TW20:
    SATW20_13960 (dapD)
    USA300_TCH1516:
    USA300HOU_1332 (dapD)
    VC40:
    SAVC_06230

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVQHLTAEEIIQYISDAKKSTPIKVYLNGNFEGITYPESFKVFGSEQSKVIFCEADDWKP
    N315            MVQHLTAEEIIQYISDAKKSTPIKVYLNGNFEGITYPESFKVFGSEQSKVIFCEADDWKP
    NCTC8325        MVQHLTAEEIIQYISDAKKSTPIKVYLNGNFEGITYPESFKVFGSEQSKVIFCEADDWKP
    Newman          MVQHLTAEEIIQYISDAKKSTPIKVYLNGNFEGITYPESFKVFGSEQSKVIFCEADDWKP
    USA300_FPR3757  MVQHLTAEEIIQYISDAKKSTPIKVYLNGNFEGITYPESFKVFGSEQSKVIFCEADDWKP
                    ************************************************************

    COL             FYEAYGSQFEDIEIEMDRRNSAIPLKDLTNTNARIEPGAFIREQAIIEDGAVVMMGATIN
    N315            FYEAYGSQFEDIEIEMDRRNSAIPLKDLTNTNARIEPGAFIREQAIIEDGAVVMMGATIN
    NCTC8325        FYEAYGSQFEDIEIEMDRRNSAIPLKDLTNTNARIEPGAFIREQAIIEDGAVVMMGATIN
    Newman          FYEAYGSQFEDIEIEMDRRNSAIPLKDLTNTNARIEPGAFIREQAIIEDGAVVMMGATIN
    USA300_FPR3757  FYEAYGSQFEDIEIEMDRRNSAIPLKDLTNTNARIEPGAFIREQAIIEDGAVVMMGATIN
                    ************************************************************

    COL             IGAVVGEGTMIDMNATLGGRATTGKNVHVGAGAVLAGVIEPPSASPVIIEDDVLIGANAV
    N315            IGAVVGEGTMIDMNATLGGRATTGKNVHVGAGAVLAGVIEPPSASPVIIEDDVLIGANAV
    NCTC8325        IGAVVGEGTMIDMNATLGGRATTGKNVHVGAGAVLAGVIEPPSASPVIIEDDVLIGANAV
    Newman          IGAVVGEGTMIDMNATLGGRATTGKNVHVGAGAVLAGVIEPPSASPVIIEDDVLIGANAV
    USA300_FPR3757  IGAVVGEGTMIDMNATLGGRATTGKNVHVGAGAVLAGVIEPPSASPVIIEDDVLIGANAV
                    ************************************************************

    COL             ILEGVRVGKGAIVAAGAIVTQDVPAGAVVAGTPAKVIKQASEVQDTKKEIVAALRKLND
    N315            ILEGVRVGKGAIVAAGAIVTQDVPAGAVVAGTPAKVIKQASEVQDTKKEIVAALRKLND
    NCTC8325        ILEGVRVGKGAIVAAGAIVTQDVPAGAVVAGTPAKVIKQASEVQDTKKEIVAALRKLND
    Newman          ILEGVRVGKGAIVAAGAIVTQDVPAGAVVAGTPCKVIKAASEVQDTKKEIVAALRKLND
    USA300_FPR3757  ILEGVRVGKGAIVAAGAIVTQDVPAGAVVAGTPAKVIKQASEVQDTKKEIVAALRKLND
                    *********************************.**** ********************