From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003817000
  • symbol?: cspA
  • description?: cold-shock protein CspA

      descriptions from strain specific annotations:

    • cold-shock protein CspA
    • CSD family cold shock protein
    • cold shock protein
    • major cold-shock protein CspA
    • cold-shock DNA-binding domain-containing protein
    • cold shock protein, CSD family
    • cold shock protein cspD
    • DNA-binding cold-shock protein
    • major cold shock protein
    • putative cold-shock DNA-binding domain protein
  • strand?: -
  • coordinates?: 4108598..4108798
  • synteny block?: BlockID0028740
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1234 (cspA)
    NCTC8325:
    Newman:
    NWMN_1313 (cspA)
    USA300_FPR3757:
    04-02981:
    SA2981_1356 (cspA)
    08BA02176:
    C248_1442 (cspA)
    11819-97:
    MS7_1358
    71193:
    ST398NM01_1404
    ECT-R 2:
    ECTR2_1259
    ED133:
    SAOV_1412c (cspA)
    ED98:
    SAAV_1386
    HO 5096 0412:
    SAEMRSA15_12650 (cspA)
    JH1:
    SaurJH1_1492
    JH9:
    SaurJH9_1463
    JKD6008:
    SAA6008_01366 (cspA)
    JKD6159:
    SAA6159_01269 (cspA)
    LGA251:
    SARLGA251_13190 (cspA)
    M013:
    M013TW_1347
    MRSA252:
    SAR1414 (cspA)
    MSHR1132:
    SAMSHR1132_12430
    MSSA476:
    SAS1343
    Mu3:
    SAHV_1390 (cspA)
    Mu50:
    SAV1402 (cspA)
    MW2:
    MW1290 (cspA)
    RF122:
    SAB1258c (cspA)
    ST398:
    SAPIG1404
    T0131:
    SAT0131_01477
    TCH60:
    HMPREF0772_11807 (cspA)
    TW20:
    SATW20_14010 (cspA)
    USA300_TCH1516:
    USA300HOU_1337 (cspA)
    VC40:
    SAVC_06255 (cspA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKQGTVKWFNAEKGFGFIEVEGENDVFVHFSAINQDGYKSLEEGQAVEFEVVEGDRGPQA
    N315            MKQGTVKWFNAEKGFGFIEVEGENDVFVHFSAINQDGYKSLEEGQAVEFEVVEGDRGPQA
    NCTC8325        MKQGTVKWFNAEKGFGFIEVEGENDVFVHFSAINQDGYKSLEEGQAVEFEVVEGDRGPQA
    Newman          MKQGTVKWFNAEKGFGFIEVEGENDVFVHFSAINQDGYKSLEEGQAVEFEVVEGDRGPQA
    USA300_FPR3757  MKQGTVKWFNAEKGFGFIEVEGENDVFVHFSAINQDGYKSLEEGQAVEFEVVEGDRGPQA
                    ************************************************************

    COL             ANVVKL
    N315            ANVVKL
    NCTC8325        ANVVKL
    Newman          ANVVKL
    USA300_FPR3757  ANVVKL
                    ******