From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003822000
  • symbol?:
  • description?: tellurite resistance protein TelA

      descriptions from strain specific annotations:

    • tellurite resistance protein TelA
    • tellurite resistance protein
    • putative tellurite resistance protein
    • TelA-like protein
    • tellurite resistance protein, putative
    • toxic anion resistance family protein
    • toxic anion resistance protein (TelA) family protein
    • toxic anion resistance protein, TelA
    • toxic anion resistance protein TelA
    • toxic ion resistance protein
  • strand?: +
  • coordinates?: 4110389..4111528
  • synteny block?: BlockID0028790
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1360
    08BA02176:
    C248_1445
    11819-97:
    MS7_1362
    71193:
    ST398NM01_1408
    ECT-R 2:
    ECTR2_1263
    ED133:
    SAOV_1416
    ED98:
    SAAV_1390
    HO 5096 0412:
    SAEMRSA15_12690
    JH1:
    SaurJH1_1496
    JH9:
    SaurJH9_1467
    JKD6008:
    SAA6008_01370 (telA)
    JKD6159:
    SAA6159_01273 (telA)
    LGA251:
    SARLGA251_13230
    M013:
    M013TW_1351
    MRSA252:
    SAR1418
    MSHR1132:
    SAMSHR1132_12470
    MSSA476:
    SAS1347
    Mu3:
    SAHV_1394
    Mu50:
    SAV1406
    MW2:
    MW1294
    RF122:
    SAB1262
    ST398:
    SAPIG1408
    T0131:
    SAT0131_01481
    TCH60:
    HMPREF0772_11803
    TW20:
    SATW20_14050
    USA300_TCH1516:
    USA300HOU_1339 (telA)
    VC40:
    SAVC_06275

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -MTENKSFKESHPLDDFISDKELSNTTIQKEKLTIEQQKQVDTISKQINPLDNEGLLAFG
    N315            -MTENKSFKESHPLDDFISDKELSNTTIQKEKLTIEQQKQVDTISKQINPLDNEGLLAFG
    NCTC8325        -MTENKSFKESHPLDDFISDKELSNTTIQKEKLTIEQQKQVDTISKQINPLDNEGLLAFG
    Newman          MMTENKSFKESHPLDDFISDKELSNTTIQKEKLTIEQQKQVDTISKQINPLDNEGLLAFG
    USA300_FPR3757  -MTENKSFKESHPLDDFISDKELSNTTIQKEKLTIEQQKQVDTISKQINPLDNEGLLAFG
                     ***********************************************************

    COL             SDLQKQMSQFSHQMLDEVQSKDVGPIGDTLSDLMSKLKSVNPNELNTDKPSMLKRIFSRA
    N315            SDLQKQMSQFSHQMLDEVQSKDVGPIGDTLSDLMSKLKSVNPNELNTDKPSMLKRIFSRA
    NCTC8325        SDLQKQMSQFSHQMLDEVQSKDVGPIGDTLSDLMSKLKSVNPNELNTDKPSMLKRIFSRA
    Newman          SDLQKQMSQFSHQMLDEVQSKDVGPIGDTLSDLMSKLKSVNPNELNTDKPSMLKRIFSRA
    USA300_FPR3757  SDLQKQMSQFSHQMLDEVQSKDVGPIGDTLSDLMSKLKSVNPNELNTDKPSMLKRIFSRA
                    ************************************************************

    COL             KSSINEIFSRMQSVSAQVDRITIQLQKHQTHLTRDIELLDTLYDKNKQYFDDLSLHIIAA
    N315            KSSINEIFSRMQSVSAQVDRITIQLQKHQTHLTRDIELLDTLYDKNKQYFDDLSLHIIAA
    NCTC8325        KSSINEIFSRMQSVSAQVDRITIQLQKHQTHLTRDIELLDTLYDKNKQYFDDLSLHIIAA
    Newman          KSSINEIFSRMQSVSAQVDRITIQLQKHQTHLTRDIELLDTLYDKNKQYFDDLSLHIIAA
    USA300_FPR3757  KSSINEIFSRMQSVSAQVDRITIQLQKHQTHLTRDIELLDTLYDKNKQYFDDLSLHIIAA
                    ************************************************************

    COL             QQKKLQLENEKLPQLQQQAQQSTNQMDIQQVADMQQFIDRLDKRIYDLQLSRQIALQTAP
    N315            QQKKLQLENEKLPQLQQQAQQSTNQMDIQQVSDMQQFIDRLDKRIYDLQLSRQIALQTAP
    NCTC8325        QQKKLQLENEKLPQLQQQAQQSTNQMDIQQVADMQQFIDRLDKRIYDLQLSRQIALQTAP
    Newman          QQKKLQLENEKLPQLQQQAQQSTNQMDIQQVADMQQFIDRLDKRIYDLQLSRQIALQTAP
    USA300_FPR3757  QQKKLQLENEKLPQLQQQAQQSTNQMDIQQVADMQQFIDRLDKRIYDLQLSRQIALQTAP
                    *******************************:****************************

    COL             QIRMIQNVNQALAEKIQSSILTSIPLWKNQMAIALTLMRQRNAVAAQRAVTDTTNDLLTA
    N315            QIRMIQNVNQALAEKIQSSILTSIPLWKNQMAIALTLMRQRNAVAAQRAVTDTTNDLLTA
    NCTC8325        QIRMIQNVNQALAEKIQSSILTSIPLWKNQMAIALTLMRQRNAVAAQRAVTDTTNDLLTA
    Newman          QIRMIQNVNQALAEKIQSSILTSIPLWKNQMAIALTLMRQRNAVAAQRAVTDTTNDLLTA
    USA300_FPR3757  QIRMIQNVNQALAEKIQSSILTSIPLWKNQMAIALTLMRQRNAVAAQRAVTDTTNDLLTA
                    ************************************************************

    COL             NAEMLKQNAIETATENERGIVDLDTLKRTQRNIIETIEETLIIQQHGREERQLAEKELQQ
    N315            NAEMLKQNAIETATENERGIVDLDTLKRTQRNIIETIEETLIIQQHGREERQLAEKELQQ
    NCTC8325        NAEMLKQNAIETATENERGIVDLDTLKRTQRNIIETIEETLIIQQHGREERQLAEKELQQ
    Newman          NAEMLKQNAIETATENERGIVDLDTLKRTQRNIIETIEETLIIQQHGREERQLAEKELQQ
    USA300_FPR3757  NAEMLKQNAIETATENERGIVDLDTLKRTQRNIIETIEETLIIQQHGREERQLAEKELQQ
                    ************************************************************

    COL             LEQDLKSHLVNIKGPNKQS
    N315            LEQDLKSHLVNIKGPNKQS
    NCTC8325        LEQDLKSHLVNIKGPNKQS
    Newman          LEQDLKSHLVNIKGPNKQS
    USA300_FPR3757  LEQDLKSHLVNIKGPNKQS
                    *******************