Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003830000
  • symbol?: sucB
  • description?: dihydrolipoamide succinyltransferase

      descriptions from strain specific annotations:

    • dihydrolipoamide succinyltransferase
    • Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
    • dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex
    • dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
    • dihydrolipoamide succinyltransferase E2 component of 2-oxoglutarate dehydrogenase complex
    • Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  • strand?: -
  • coordinates?: 4119140..4120514
  • synteny block?: BlockID0028870
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1448 (sucB)
    N315:
    SA1244 (odhB)
    NCTC8325:
    Newman:
    NWMN_1325 (sucB)
    USA300_FPR3757:
    04-02981:
    SA2981_1366 (odhB)
    08BA02176:
    C248_1451 (odhB)
    11819-97:
    MS7_1368 (sucB)
    71193:
    ST398NM01_1414
    ECT-R 2:
    ECTR2_1269 (sucB)
    ED133:
    SAOV_1422c
    ED98:
    SAAV_1396 (sucB)
    HO 5096 0412:
    SAEMRSA15_12750 (odhB)
    JH1:
    SaurJH1_1502
    JH9:
    SaurJH9_1473
    JKD6008:
    SAA6008_01378 (odhB)
    JKD6159:
    SAA6159_01279 (odhB)
    LGA251:
    SARLGA251_13290 (odhB)
    M013:
    M013TW_1357
    MRSA252:
    SAR1424 (odhB)
    MSHR1132:
    SAMSHR1132_12530
    MSSA476:
    SAS1355
    Mu3:
    SAHV_1400 (odhB)
    Mu50:
    SAV1412 (odhB)
    MW2:
    MW1302 (odhB)
    RF122:
    SAB1268c (odhB)
    ST398:
    SAPIG1414 (sucB)
    T0131:
    SAT0131_01490
    TCH60:
    HMPREF0772_11797 (sucB)
    TW20:
    SATW20_14130 (odhB)
    USA300_TCH1516:
    USA300HOU_1347 (odhB)
    VC40:
    SAVC_06310

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLA
    N315            MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLA
    NCTC8325        MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLA
    Newman          MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLA
    USA300_FPR3757  MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLA
                    ************************************************************

    COL             SEGDTVEVGQAIAIIGEGSGNASKENSNDNTPQQNEETNNKKEETTNNSVDKAEVNQAND
    N315            SEGDTVEVGQAIAIIGEGSGNASKENSNDNTPQQNEETNNKKEETTNNSVDKAEVNQAND
    NCTC8325        SEGDTVEVGQAIAIIGEGSGNASKENSNDNTPQQNEETNNKKEETTNNSVDKAEVNQAND
    Newman          SEGDTVEVGQAIAIIGEGSGNASKENSNDNTPQQNEETNNKKEETTNNSVDKAEVNQAND
    USA300_FPR3757  SEGDTVEVGQAIAIIGEGSGNASKENSNDNTPQQNEETNNKKEETTNNSVDKAEVNQAND
                    ************************************************************

    COL             DNQQRINATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQASAKEE
    N315            DNQQRINATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQAPAKEE
    NCTC8325        DNQQRINATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQASAKEE
    Newman          DNQQRINATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQASAKEE
    USA300_FPR3757  DNQQRINATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQASAKEE
                    *******************************************************.****

    COL             KKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFM
    N315            KKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFM
    NCTC8325        KKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFM
    Newman          KKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFM
    USA300_FPR3757  KKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFM
                    ************************************************************

    COL             KDHDGTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPFV
    N315            KDHDGTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPFV
    NCTC8325        KDHDGTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPFV
    Newman          KDHDGTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPFV
    USA300_FPR3757  KDHDGTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPFV
                    ************************************************************

    COL             RDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQAA
    N315            RDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQAA
    NCTC8325        RDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQAA
    Newman          RDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQAA
    USA300_FPR3757  RDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQAA
                    ************************************************************

    COL             ILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
    N315            ILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
    NCTC8325        ILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
    Newman          ILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
    USA300_FPR3757  ILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
                    ************************************************************

    COL             ES
    N315            ES
    NCTC8325        ES
    Newman          ES
    USA300_FPR3757  ES
                    **