From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003856000
  • symbol?: msrA1
  • description?: methionine sulfoxide reductase A

      descriptions from strain specific annotations:

    • methionine sulfoxide reductase A
    • peptide-methionine (S)-S-oxide reductase
    • peptide methionine sulfoxide reductase II
    • Peptide methionine sulfoxide reductase MsrA
    • methionine-S-sulfoxide reductase
    • peptide methionine sulfoxide reductase
    • peptide methionine sulfoxide reductase MsrA 2
  • strand?: -
  • coordinates?: 4138204..4138737
  • synteny block?: BlockID0029120
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    NWMN_1335 (msrA)
    USA300_FPR3757:
    04-02981:
    SA2981_1378 (msrA)
    08BA02176:
    C248_1464 (msrA2)
    11819-97:
    MS7_1380 (msrA2)
    71193:
    ST398NM01_1425
    ECT-R 2:
    ECTR2_1280 (msrA)
    ED133:
    SAOV_1433c
    ED98:
    SAAV_1407 (msrA)
    HO 5096 0412:
    SAEMRSA15_12870 (msrA2)
    JH1:
    SaurJH1_1513
    JH9:
    SaurJH9_1484
    JKD6008:
    SAA6008_01392
    JKD6159:
    SAA6159_01291
    LGA251:
    SARLGA251_13400 (msrA1)
    M013:
    M013TW_1370
    MRSA252:
    SAR1437 (msrA2)
    MSHR1132:
    SAMSHR1132_12660
    MSSA476:
    SAS1367
    Mu3:
    SAHV_1412
    Mu50:
    SAV1424
    MW2:
    MW1314
    RF122:
    SAB1279c (msrA)
    ST398:
    SAPIG1425 (msrA)
    T0131:
    SAT0131_01504 (xpt)
    TCH60:
    HMPREF0772_11782 (msrA2)
    TW20:
    SATW20_14250 (msrA1)
    USA300_TCH1516:
    USA300HOU_1361 (msrA2)
    VC40:
    SAVC_06370

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            MTKEYATLAGGCFWCMVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNKTGHVEAVQIT
    NCTC8325        MTKEYATLAGGCFWCMVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNQTGHVEAVQIT
    Newman          MTKEYATLAGGCFWCMVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNQTGHVEAVQIT
    USA300_FPR3757  MTKEYATLAGGCFWCMVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNQTGHVEAVQIT
                    *************************************************:**********

    N315            FDPEVTSFENILDIYFKTFDPTDDQGQFFDRGESYQPVIFYHDEHQKKAAEFKKQQLNEQ
    NCTC8325        FDPEVTSFENILDIYFKTFDPTDDQGQFFDRGESYQPVIFYHDEHQKKAAEFKKQQLNEQ
    Newman          FDPEVTSFENILDIYFKTFDPTDDQGQFFDRGESYQPVIFYHDEHQKKAAEFKKQQLNEQ
    USA300_FPR3757  FDPEVTSFENILDIYFKTFDPTDDQGQFFDRGESYQPVIFYHDEHQKKAAEFKKQQLNEQ
                    ************************************************************

    N315            GIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVHYYQYQRGSGRKAFIESHWGNQNA
    NCTC8325        GIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVHYYQYQRGSGRKAFIESHWGNQNA
    Newman          GIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVHYYQYQRGSGRKAFIESHWGNQNA
    USA300_FPR3757  GIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVHYYQYQRGSGRKAFIESHWGNQNA
                    *********************************************************