From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003857000
  • symbol?: fakB2
  • description?: degV family protein

      descriptions from strain specific annotations:

    • degV family protein
    • DegVA
    • degV domain-containing protein
    • DegV domain-containing protein MW1315
    • fatty acid-binding protein, DegV family
    • putative fatty acid-binding protein
  • strand?: -
  • coordinates?: 4138827..4139666
  • synteny block?: BlockID0029130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1379
    08BA02176:
    C248_1465
    11819-97:
    MS7_1381
    71193:
    ST398NM01_1426
    ECT-R 2:
    ECTR2_1281
    ED133:
    SAOV_1434c
    ED98:
    SAAV_1408
    HO 5096 0412:
    SAEMRSA15_12880
    JH1:
    SaurJH1_1514
    JH9:
    SaurJH9_1485
    JKD6008:
    SAA6008_01393
    JKD6159:
    SAA6159_01292
    LGA251:
    SARLGA251_13410
    M013:
    M013TW_1371
    MRSA252:
    SAR1438
    MSHR1132:
    SAMSHR1132_12670
    MSSA476:
    SAS1368
    Mu3:
    SAHV_1413
    Mu50:
    SAV1425
    MW2:
    MW1315
    RF122:
    SAB1280c
    ST398:
    SAPIG1426
    T0131:
    SAT0131_01505 (pbuX)
    TCH60:
    HMPREF0772_11781
    TW20:
    SATW20_14260
    USA300_TCH1516:
    USA300HOU_1362
    VC40:
    SAVC_06375

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKQIIVTDSTSDLSKEYLEANNIHVIPLSLTIEGASYVDQVDITSEEFINHIENDEDVK
    N315            MTKQIIVTDSTSDLSKEYLEANNIHVIPLSLTIEGASYVDQVDITSEEFINHIENDEDVK
    NCTC8325        MTKQIIVTDSTSDLSKEYLEANNIHVIPLSLTIEGASYVDQVDITSEEFINHIENDEDVK
    Newman          MTKQIIVTDSTSDLSKEYLEANNIHVIPLSLTIEGASYVDQVDITSEEFINHIENDEDVK
    USA300_FPR3757  MTKQIIVTDSTSDLSKEYLEANNIHVIPLSLTIEGASYVDQVDITSEEFINHIENDEDVK
                    ************************************************************

    COL             TSQPAIGEFISAYEELGKDGSEIISIHLSSGLSGTYNTAYQASQMVDANVTVIDSKSISF
    N315            TSQPAIGEFISAYEELGKDGSEIISIHLSSGLSGTYNTAYQASQMVDANVTVIDSKSISF
    NCTC8325        TSQPAIGEFISAYEELGKDGSEIISIHLSSGLSGTYNTAYQASQMVDANVTVIDSKSISF
    Newman          TSQPAIGEFISAYEELGKDGSEIISIHLSSGLSGTYNTAYQASQMVDANVTVIDSKSISF
    USA300_FPR3757  TSQPAIGEFISAYEELGKDGSEIISIHLSSGLSGTYNTAYQASQMVDANVTVIDSKSISF
                    ************************************************************

    COL             GLGYQIQHLVELVKEGVSTSEIVKKLNHLRENIKLFVVIGQLNQLIKGGRISKTKGLIGN
    N315            SLGYQIQHLVELVKEGVSTSEIVKKLNHLRENIKLFVVIGQLNQLIKGGRISKTKGLIGN
    NCTC8325        GLGYQIQHLVELVKEGVSTSEIVKKLNHLRENIKLFVVIGQLNQLIKGGRISKTKGLIGN
    Newman          GLGYQIQHLVELVKEGVSTSEIVKKLNHLRENIKLFVVIGQLNQLIKGGRISKTKGLIGN
    USA300_FPR3757  GLGYQIQHLVELVKEGVSTSEIVKKLNHLRENIKLFVVIGQLNQLIKGGRISKTKGLIGN
                    .***********************************************************

    COL             LMKIKPIGTLDDGRLELVHNARTQNSSIQYLKKEIAEFIGDHEIKSIGVAHANVIEYVDK
    N315            LMKIKPIGTLDDGRLELVHNARTQNSSIQYLKKEIAEFIGDHEIKSIGVAHANVIEYVDK
    NCTC8325        LMKIKPIGTLDDGRLELVHNARTQNSSIQYLKKEIAEFIGDHEIKSIGVAHANVIEYVDK
    Newman          LMKIKPIGTLDDGRLELVHNARTQNSSIQYLKKEIAEFIGDHEIKSIGVAHANVIEYVDK
    USA300_FPR3757  LMKIKPIGTLDDGRLELVHNARTQNSSIQYLKKEIAEFIGDHEIKSIGVAHANVIEYVDK
                    ************************************************************

    COL             LKKVFNEAFHVNNYDINVTTPVISAHTGQGAIGLVVLKK
    N315            LKKVFNEAFHVNNYDINVTTPVISAHTGQGAIGLVVLKK
    NCTC8325        LKKVFNEAFHVNNYDINVTTPVISAHTGQGAIGLVVLKK
    Newman          LKKVFNEAFHVNNYDINVTTPVISAHTGQGAIGLVVLKK
    USA300_FPR3757  LKKVFNEAFHVNNYDINVTTPVISAHTGQGAIGLVVLKK
                    ***************************************