From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003861000
  • symbol?: cvfC
  • description?: HEAT repeat-containing PBS lyase

      descriptions from strain specific annotations:

    • HEAT repeat-containing PBS lyase
    • PBS lyase HEAT-like repeat domain protein
    • PBS lyase HEAT-like repeat family protein
    • virulence factor C
    • Fe-S cluster assembly protein
    • PBS lyase HEAT-like repeat domain-containing protein
    • conserved virulence factor C
    • PBS lyase HEAT-like repeat protein
  • strand?: -
  • coordinates?: 4142283..4143409
  • synteny block?: BlockID0029170
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1383
    08BA02176:
    C248_1469
    11819-97:
    MS7_1385 (cvfC)
    71193:
    ST398NM01_1430
    ECT-R 2:
    ECTR2_1285
    ED133:
    SAOV_1438c
    ED98:
    SAAV_1412
    HO 5096 0412:
    SAEMRSA15_12920
    JH1:
    SaurJH1_1518
    JH9:
    SaurJH9_1489
    JKD6008:
    SAA6008_01397 (nifU)
    JKD6159:
    SAA6159_01296 (nifU)
    LGA251:
    SARLGA251_13450 (cvfC)
    M013:
    M013TW_1375
    MRSA252:
    SAR1442
    MSHR1132:
    SAMSHR1132_12710
    MSSA476:
    SAS1372
    Mu3:
    SAHV_1417
    Mu50:
    SAV1429
    MW2:
    MW1319
    RF122:
    SAB1284c
    ST398:
    SAPIG1430
    T0131:
    SAT0131_01510 (pnpA)
    TCH60:
    HMPREF0772_11777
    TW20:
    SATW20_14300 (cvfC)
    USA300_TCH1516:
    USA300HOU_1366
    VC40:
    SAVC_06395

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEILRIEPTPSPNTMKVVLSYTREDKLSNTYKKVEETQPRFINQLLSIDGITSIFHVMNF
    N315            MEILRIEPTPSPNTMKVVLSYTREDKLSNTYKKVEETQPRFINQLLSIDGITSIFHVMNF
    NCTC8325        MEILRIEPTPSPNTMKVVLSYTREDKLSNTYKKVEETQPRFINQLLSIDGITSIFHVMNF
    Newman          MEILRIEPTPSPNTMKVVLSYTREDKLSNTYKKVEETQPRFINQLLSIDGITSIFHVMNF
    USA300_FPR3757  MEILRIEPTPSPNTMKVVLSYTREDKLSNTYKKVEETQPRFINQLLSIDGITSIFHVMNF
                    ************************************************************

    COL             LAVDKAPKADWEVILPDIKAAFSDANKVLESVNEPQIDNHFGEIKAELLTFKGIPYQIKL
    N315            LAVDKAPKADWEVILPDIKAAFSDANKVLESVNEPQIDNHFGEIKAELLTFKGIPYQIKL
    NCTC8325        LAVDKAPKADWEVILPDIKAAFSDANKVLESVNEPQIDNHFGEIKAELLTFKGIPYQIKL
    Newman          LAVDKAPKADWEVILPDIKAAFSDANKVLESVNEPQIDNHFGEIKAELLTFKGIPYQIKL
    USA300_FPR3757  LAVDKAPKADWEVILPDIKAAFSDANKVLESVNEPQIDNHFGEIKAELLTFKGIPYQIKL
                    ************************************************************

    COL             TSADQELREQLPQTYVDHMTQAQTAHDNIVFMRKWLDLGNRYGNIQEVMDGVLEEVLATY
    N315            TSADQELREQLPQTYVDHMTQAQTAHDNIVFMRKWLDLGNRYGNIEEVMDGVLEEVLATY
    NCTC8325        TSADQELREQLPQTYVDHMTQAQTAHDNIVFMRKWLDLGNRYGNIQEVMDGVLEEVLATY
    Newman          TSADQELREQLPQTYVDHMTQAQTAHDNIVFMRKWLDLGNRYGNIQEVMDGVLEEVLATY
    USA300_FPR3757  TSADQELREQLPQTYVDHMTQAQTAHDNIVFMRKWLDLGNRYGNIQEVMDGVLEEVLTTY
                    *********************************************:***********:**

    COL             PESQLPVLVKHALEENHATNNYHFYRHVSLDEYHATDNWKTRLRMLNHFPKPTFEDIPLL
    N315            PESQLPVLVKHALEENHATNNYHFYRHVSLDEYHATDNWKTRLRMLNHFPKPTFEDIPLL
    NCTC8325        PESQLPVLVKHALEENHATNNYHFYRHVSLDEYHATDNWKTRLRMLNHFPKPTFEDIPLL
    Newman          PESQLPVLVKHALEENHATNNYHFYRHVSLDEYHATDNWKTRLRMLNHFPKPTFEDIPLL
    USA300_FPR3757  PESQLPVLVKHALEENHATNNYHFYRHVSLDEYHATDNWKTRLRMLNHFPKPTFEDIPLL
                    ************************************************************

    COL             DLALSDEKVPVRRQAIVLLGMIESKEILPYLYKGLRDKSPAVRRTAGDCISDLGYPEALP
    N315            DLALSDEKVPVRRQAIVLLGMIESKEILPYLYKGLRDKSPAVRRTAGDCISDLGYPEALP
    NCTC8325        DLALSDEKVPVRRQAIVLLGMIESKEILPYLYKGLRDKSPAVRRTAGDCISDLGYPEALP
    Newman          DLALSDEKVPVRRQAIVLLGMIESKEILPYLYKGLRDKSPAVRRTAGDCISDLGYPEALP
    USA300_FPR3757  DLALSDEKVPVRRQAIVLLGMIESKEILPYLYKGLRDKSPVVRRTAGDCISDLGYPEALP
                    ****************************************.*******************

    COL             EMVLLLDDPQKIVRWRAAMFIFDEGNAEQLPALKAHINDNAFEVKLQIEMAISRIENGDE
    N315            EMVLLLDDPQKIVRWRAAMFIFDEGNAEQLPALKAHINDNAFEVKLQIEMAISRIENGDE
    NCTC8325        EMVLLLDDPQKIVRWRAAMFIFDEGNAEQLPALKAHINDNAFEVKLQIEMAISRIENGDE
    Newman          EMVLLLDDPQKIVRWRAAMFIFDEGNAEQLPALKAHINDNAFEVKLQIEMAISRIENGDE
    USA300_FPR3757  EMVLLLDDPQKIVRWRAAMFIFDEGNAEQLPALKAHINDNAFEVKLQIEMAISRIENGDE
                    ************************************************************

    COL             ALGSVWKQMANRTI
    N315            ALGSVWKQMANRTI
    NCTC8325        ALGSVWKQMANRTI
    Newman          ALGSVWKQMANRTI
    USA300_FPR3757  ALGSVWKQMANRTI
                    **************