From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003862000
  • symbol?:
  • description?: Scaffold protein Nfu/NifU N terminal

      descriptions from strain specific annotations:

    • Scaffold protein Nfu/NifU N terminal
    • chain A, X-Ray Crystal Structure Of Protein Sav1430 From Staphylococcus aureus subsp. aureus ECT-R 2. Northeast Structural Genomics Consortium Target Zr18
    • conserved virulence factor C
    • PBS lyase HEAT-like repeat protein
  • strand?: -
  • coordinates?: 4143448..4143657
  • synteny block?: BlockID0029180
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1384
    08BA02176:
    C248_1470
    11819-97:
    MS7_1386
    71193:
    ST398NM01_1431
    ECT-R 2:
    ECTR2_1286
    ED133:
    SAOV_1439c
    ED98:
    SAAV_1413
    HO 5096 0412:
    SAEMRSA15_12930
    JH1:
    SaurJH1_1519
    JH9:
    SaurJH9_1490
    JKD6008:
    SAA6008_01398
    JKD6159:
    SAA6159_01297
    LGA251:
    SARLGA251_13460
    M013:
    M013TW_1376
    MRSA252:
    SAR1443
    MSHR1132:
    SAMSHR1132_12720
    MSSA476:
    SAS1373
    Mu3:
    SAHV_1418
    Mu50:
    SAV1430
    MW2:
    MW1320
    RF122:
    SAB1285c
    ST398:
    SAPIG1431
    T0131:
    SAT0131_01511
    TCH60:
    HMPREF0772_11776
    TW20:
    SATW20_14310
    USA300_TCH1516:
    USA300HOU_1367
    VC40:
    SAVC_06400

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDF
    N315            MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDF
    NCTC8325        MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDF
    Newman          MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDF
    USA300_FPR3757  MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDF
                    ************************************************************

    COL             ISVDKENDANWETVLPKVEAVFE
    N315            ISVDKENDANWETVLPKVEAVFE
    NCTC8325        ISVDKENDANWETVLPKVEAVFE
    Newman          ISVDKENDANWETVLPKVEAVFE
    USA300_FPR3757  ISVDKENDANWETVLPKVEAVFE
                    ***********************