From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003895000
  • symbol?:
  • description?: GTPase

      descriptions from strain specific annotations:

    • GTPase
    • putative dynamin family protein
    • small GTP-binding domain protein
    • GTPases (dynamin-related)
  • strand?: -
  • coordinates?: 4216787..4220227
  • synteny block?: BlockID0029410
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1396
    08BA02176:
    C248_1480
    11819-97:
    MS7_1397
    71193:
    ST398NM01_1440
    ECT-R 2:
    ECTR2_1295
    ED133:
    SAOV_1450
    ED98:
    SAAV_1425
    HO 5096 0412:
    SAEMRSA15_13030
    JH1:
    SaurJH1_1530
    JH9:
    SaurJH9_1501
    JKD6008:
    SAA6008_01409
    JKD6159:
    SAA6159_01306
    LGA251:
    SARLGA251_13560
    M013:
    M013TW_1388
    MRSA252:
    SAR1453
    MSHR1132:
    SAMSHR1132_12820
    MSSA476:
    SAS1384
    Mu3:
    SAHV_1429
    Mu50:
    SAV1441
    MW2:
    MW1330
    RF122:
    SAB1306c
    ST398:
    SAPIG1440
    T0131:
    SAT0131_01529
    TCH60:
    HMPREF0772_11765
    TW20:
    SATW20_14410
    USA300_TCH1516:
    USA300HOU_1378
    VC40:
    SAVC_06460

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MINKEQLDLLYKLKKEVEKSRNEALLHTINQVIKKVYLQQYTCSFVGHFSAGKSTLINLL
    N315            MINKEQLDLLYKLKKEVEKSRNEALLHTINQVIKKVYLQQYTCSFVGHFSAGKSTLINLL
    NCTC8325        MINKEQLDLLYKLKKEVEKSRNEALLHTINQVIKKVYLQQYTCSFVGHFSAGKSTLINLL
    Newman          MINKEQLDLLYKLKKEVEKSRNEALLHTINQVIKKVYLQQYTCSFVGHFSAGKSTLINLL
    USA300_FPR3757  MINKEQLDLLYKLKKEVEKSRNEALLHTINQVIKKVYLQQYTCSFVGHFSAGKSTLINLL
                    ************************************************************

    COL             IEQDILPSSPVPTTSNTAIVSVSDNHDIIANLPNQTYAKLSNYDEVREMNRQNVDVESVE
    N315            IEQDILPSSPVPTTSNTAIVSVSDNHDIIANLPNQTYAKLSNYDEVREMNRQNVDVESVE
    NCTC8325        IEQDILPSSPVPTTSNTAIVSVSDNHDIIANLPNQTYAKLSNYDEVREMNRQNVDVESVE
    Newman          IEQDILPSSPVPTTSNTAIVSVSDNHDIIANLPNQTYAKLSNYDEVREMNRQNVDVESVE
    USA300_FPR3757  IEQDILPSSPVPTTSNTAIVSVSDNHDIIANLPNQTYAKLSNYDEVREMNRQNVDVESVE
                    ************************************************************

    COL             INFQSAKFENGFTLQDTPGVDSNVASHQSITEQYMYTSNMIFYTVDYNHVQSELNFKFMK
    N315            INFQSAKFENGFTLQDTPGVDSNVASHQSITEQYMYTSNMIFYTVDYNHVQSELNFKFMK
    NCTC8325        INFQSAKFENGFTLQDTPGVDSNVASHQSITEQYMYTSNMIFYTVDYNHVQSELNFKFMK
    Newman          INFQSAKFENGFTLQDTPGVDSNVASHQSITEQYMYTSNMIFYTVDYNHVQSELNFKFMK
    USA300_FPR3757  INFQSAKFENGFTLQDTPGVDSNVASHQSITEQYMYTSNMIFYTVDYNHVQSELNFKFMK
                    ************************************************************

    COL             HINDVGIPVVFIINQIDKHQDDELSFSTFKSRVEKSIADWGIKLERTFYVSKFDHPENEL
    N315            HINDVGIPVVFIINQIDKHQDDELSFSTFKSRVEKSIADWGIKLERTFYVSKFDHPENEL
    NCTC8325        HINDVGIPVVFIINQIDKHQDDELSFSTFKSRVEKSIADWGIKLERTFYVSKFDHPENEL
    Newman          HINDVGIPVVFIINQIDKHQDDELSFSTFKSRVEKSIADWGIKLERTFYVSKFDHPENEL
    USA300_FPR3757  HINDVGIPVVFIINQIDKHQDDELSFSTFKSRVEKSIADWGIKLERTFYVSKFDHPENEL
                    ************************************************************

    COL             EVLSSYLISLDQHRETIEDYTSRTVEYITEAQLDYIQSEIQEVLEDLGIEEAEFEQAFLN
    N315            EVLSSYLISLDQHRETIEDYTSRTVEYITEAQLDYIQSEIQEVLEDLGIEEAEFEQAFLN
    NCTC8325        EVLSSYLISLDQHRETIEDYTSRTVEYITEAQLDYIQSEIQEVLEDLGIEEAEFEQAFLN
    Newman          EVLSSYLISLDQHRETIEDYTSRTVEYITEAQLDYIQSEIQEVLEDLGIEEAEFEQAFLN
    USA300_FPR3757  EVLSSYLISLDQHRETIEDYTSRTVEYITEAQLDYIQSEIQEVLEDLGIEEAEFEQAFLN
                    ************************************************************

    COL             SQQHQAISEEAQLLNNPDELMAFLKNKRKNILENAYIMPHNMREMLRSYLESMSQDFNVG
    N315            SQQHQAISEEAQLLNNPDELMAFLKNKRKNILENAYIMPHNMREMLRSYLESMSQDFNVG
    NCTC8325        SQQHQAISEEAQLLNNPDELMAFLKNKRKNILENAYIMPHNMREMLRSYLESMSQDFNVG
    Newman          SQQHQAISEEAQLLNNPDELMAFLKNKRKNILENAYIMPHNMREMLRSYLESMSQDFNVG
    USA300_FPR3757  SQQHQAISEEAQLLNNPDELMAFLKNKRKNILENAYIMPHNMREMLRSYLESMSQDFNVG
                    ************************************************************

    COL             GFFNKKKKKLQIQQQRLLTATDALQEHVNQQIRQPMREDMSFVTRFINKKEASDKVLNQH
    N315            GFFNKKKKKLQIQQQRLLTATDALQEHVNQQIRQPMREDMSFVTRFINKKEASDKVLNQH
    NCTC8325        GFFNKKKKKLQIQQQRLLTATDALQEHVNQQIRQPMREDMSFVTRFINKKEASDKVLNQH
    Newman          GFFNKKKKKLQIQQQRLLTATDALQEHVNQQIRQPMREDMSFVTRFINKKEASDKVLNQH
    USA300_FPR3757  GFFNKKKKKLQIQQQRLLTATDALQEHVNQQIRQPMREDMSFVTRFINKKEASDKVLNQH
                    ************************************************************

    COL             YDVKPEMIEGLYQPQTSISNTYVLTFSDEVVKAIKKYVEQQSTPIFKEIIENVQADELPT
    N315            YDVKPEMIEDLYQPQTSISNTYVLTFSDEVVKAIKKYVEQQSTPIFKEIIENVQADELPT
    NCTC8325        YDVKPEMIEGLYQPQTSISNTYVLTFSDEVVKAIKKYVEQQSTPIFKEIIENVQADELPT
    Newman          YDVKPEMIEGLYQPQTSISNTYVLTFSDEVVKAIKKYVEQQSTPIFKEIIENVQADELPT
    USA300_FPR3757  YDVKPEMIEGLYQPQTSISNTYVLTFSDEVVKAIKKYVEQQSTPIFKEIIENVQADELPT
                    *********.**************************************************

    COL             EESDDLKEYQRYTELNELRQSLTTKNYRHYYIHLDESLDKLIGRQETTYQVATDNAQDNR
    N315            EESDDLKEYQRYTELNELRQSLTTKNYRHYYIHLDESLDKLIGRQETTYQVATDNTQDNR
    NCTC8325        EESDDLKEYQRYTELNELRQSLTTKNYRHYYIHLDESLDKLIGRQETTYQVATDNAQDNR
    Newman          EESDDLKEYQRYTELNELRQSLTTKNYRHYYIHLDESLDKLIGRQETTYQVATDNAQDNR
    USA300_FPR3757  EESDDLKEYQRYTELNELRQSLTTKNYRHYYIHLDESLDKLIGRQETTYQVATDNAQDNR
                    *******************************************************:****

    COL             DNQQLNQNTATTNMSIDIQKALDIISDVPLFKRTKQDIHETLTRIDNKLIKIGVFGTFSA
    N315            DNQQLNQNTATTNMSIDIQKALDIISDVPLFKRTKQDIHETLTRIDNKLIKIGVFGTFSA
    NCTC8325        DNQQLNQNTATTNMSIDIQKALDIISDVPLFKRTKQDIHETLTRIDNKLIKIGVFGTFSA
    Newman          DNQQLNQNTATTNMSIDIQKALDIISDVPLFKRTKQDIHETLTRIDNKLIKIGVFGTFSA
    USA300_FPR3757  DNQQLNQNTATTNMSIDIQKALDIISDVPLFKRTKQDIHETLTRIDNKLIKIGVFGTFSA
                    ************************************************************

    COL             GKSSLINALLGEHILVSSPNPTTAATTEISYGDESYITLKSQSQLLDEINAVVEYQDMSY
    N315            GKSSLINALLGEHILVSSPNPTTAATTEISYGDESYITLKSQSQLLDEINAVVEYQDISF
    NCTC8325        GKSSLINALLGEHILVSSPNPTTAATTEISYGDESYITLKSQSQLLDEINAVVEYQDMSY
    Newman          GKSSLINALLGEHILVSSPNPTTAATTEISYGDESYITLKSQSQLLDEINAVVEYQDMSY
    USA300_FPR3757  GKSSLINALLGEHILVSSPNPTTAATTEISYGDESYITLKSQSQLLDEINAVVEYQDMSY
                    *********************************************************:*:

    COL             STIEDFINSDLEKLKSHLNKNQLAFIQAVEKHYKLYVNMLENGEKHAINQQELKKWSAED
    N315            STIEEFINWDLEKLKSHLNKNQLAFIQAVEKHYKLYVNMLENGEKHAINQQELKKWSAED
    NCTC8325        STIEDFINSDLEKLKSHLNKNQLAFIQAVEKHYKLYVNMLENGEKHAINQQELKKWSAED
    Newman          STIEDFINSDLEKLKSHLNKNQLAFIQAVEKHYKLYVNMLENGEKHAINQQELKKWSAED
    USA300_FPR3757  STIEDFINSDLEKLKSHLNKNQLAFIQAVEKHYKLYVNMLENGEKHAINQQELKKWSAED
                    ****:*** ***************************************************

    COL             EYATFVKTVHIALMHDWLKGKIIVDSLGLHSNNQRHTNETEQILTSSDLILYVSYFNHSF
    N315            EYATFVKTVHIALMHDWLKGKIIVDSLGLHSNNQRHTNETEQILTSSDLILYVSYFNHSF
    NCTC8325        EYATFVKTVHIALMHDWLKGKIIVDSLGLHSNNQRHTNETEQILTSSDLILYVSYFNHSF
    Newman          EYATFVKTVHIALMHDWLKGKIIVDSLGLHSNNQRHTNETEQILTSSDLILYVSYFNHSF
    USA300_FPR3757  EYATFVKTVHIALMHDWLKGKIIVDSLGLHSNNQRHTNETEQILTSSDLILYVSYFNHSF
                    ************************************************************

    COL             TDNDKAFIEHMKDMNQLNENQAFKMVINAADLAESQDDLEAVETYVSDALRQVHLQSDIF
    N315            TDNDKAFIEHMKDMNQLNENQAFKMVINAADLAESQDDLEAVETYVSDALRQVHLQSDIF
    NCTC8325        TDNDKAFIEHMKDMNQLNENQAFKMVINAADLAESQDDLEAVETYVSDALRQVHLQSDIF
    Newman          TDNDKAFIEHMKDMNQLNENQAFKMVINAADLAESQDDLEAVETYVSDALRQVHLQSDIF
    USA300_FPR3757  TDNDKAFIEHMKDMNQLNENQALKMVINAADLAESQDDLEAVETYVSDALRQVHLQSDIF
                    **********************:*************************************

    COL             AVSSRNALQAEDKGIDQLKQSIQQFVDVESKSILEQQMIHQLQQMDRSYVEMITEFETNK
    N315            AVSSRNALQAEDKGIDQLKQSIQQFVDVESKSILEQQMIHQLQQMDRSYVEMITEFETNK
    NCTC8325        AVSSRNALQAEDKGIDQLKQSIQQFVDVESKSILEQQMIHQLQQMDRSYVEMITEFETNK
    Newman          AVSSRNALQAEDKGIDQLKQSIQQFVDVESKSILEQQMIHQLQQMDRSYVEMITEFETNK
    USA300_FPR3757  AVSSRNALQAEDKGIDQLKQSIQQFVDVESKSILEQQMIHQLQQMDRSYVEMITEFETNK
                    ************************************************************

    COL             ADISRRQQRLTDYKDKQRLQHQLIDATLQHTDNEVEEQVYHLNARLKLQLLDDVKSVFNS
    N315            ADISRRQQRLTDYKDKQRLQHQLIDATLQHTDNEVEEQVYHLNARLKLQLLDDVKSVFNS
    NCTC8325        ADISRRQQRLTDYKDKQRLQHQLIDATLQHTDNEVEEQVYHLNARLKLQLLDDVKSVFNS
    Newman          ADISRRQQRLTDYKDKQRLQHQLIDATLQHTDNEVEEQVYHLNARLKLQLLDDVKSVFNS
    USA300_FPR3757  ADISRRQQRLTDYKDKQRLQHQLIDATLQHTDNEVEEQVYHLNARLKLQLLDDVKSVFNS
                    ************************************************************

    COL             QMTQNSDFNEEKKVSTRVYLDQIHQRLFLEQSLITERIKKYFNKQLTEQIAPIVQQLADL
    N315            QMTQNSDFNEEKKVSTKVYLDQIHQRLFLEQSLITERIKKYFNKQLTKQIAPIVQQLADL
    NCTC8325        QMTQNSDFNEEKKVSTRVYLDQIHQRLFLEQSLITERIKKYFNKQLTEQIAPIVQQLADL
    Newman          QMTQNSDFNEEKKVSTRVYLDQIHQRLFLEQSLITERIKKYFNKQLTEQIAPIVQQLADL
    USA300_FPR3757  QMTQNSDFNEEKKVSTRVYLDQIHQRLFLEQSLITERIKKYFNKQLTEQIAPIVQQLADL
                    ****************:******************************:************

    COL             HVIINPQFNFESANIEQPLLHIDFNDMLNALPKQLTKRKILNPNGQRDIHESICQSTLGL
    N315            HVIVNPQFNFESANIEQPLLHIDFNDMLNALPKQLTKRKILNPNGQRDIHESICQSTLGL
    NCTC8325        HVIINPQFNFESANIEQPLLHIDFNDMLNALPKQLTKRKILNPNGQRDIHESICQSTLGL
    Newman          HVIINPQFNFESANIEQPLLHIDFNDMLNALPKQLTKRKILNPNGQRDIHESICQSTLGL
    USA300_FPR3757  HVIINPQFNFESANIEQPLLHIDFNDMLNALPKQLTKRKILNPNGQRDIHESICQSTLEL
                    ***:****************************************************** *

    COL             LQPQMGLLRQQLELYVKQMAVEAESQFESFEANIQTQINDLLAFDLDTTLINQLKDKHQQ
    N315            LQPQMGLLRQQLELYVKQMAVEAESQFESFEANIQTQINDLLAFDLDTTLINQLKDKHQQ
    NCTC8325        LQPQMGLLRQQLELYVKQMAVEAESQFESFEANIQTQINDLLAFDLDTTLINQLKDKHQQ
    Newman          LQPQMGLLRQQLELYVKQMAVEAESQFESFEANIQTQINDLLAFDLDTTLINQLKDKHQQ
    USA300_FPR3757  LQPQMGLLRQQLELYVKQMAVEAESQFESFEANIQTQINDLLAFDLDTTLINQLKDKHQQ
                    ************************************************************

    COL             LKTILY
    N315            LKTILY
    NCTC8325        LKTILY
    Newman          LKTILY
    USA300_FPR3757  LKTILY
                    ******