From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003899000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 4222659..4222991
  • synteny block?: BlockID0029450
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1398
    08BA02176:
    C248_1482
    11819-97:
    MS7_1399
    71193:
    ST398NM01_1442
    ECT-R 2:
    ECTR2_1297
    ED133:
    SAOV_1452
    ED98:
    SAAV_1427
    HO 5096 0412:
    SAEMRSA15_13050
    JH1:
    SaurJH1_1532
    JH9:
    SaurJH9_1503
    JKD6008:
    SAA6008_01411
    JKD6159:
    SAA6159_01308
    LGA251:
    SARLGA251_13580
    M013:
    M013TW_1390
    MRSA252:
    SAR1455
    MSHR1132:
    SAMSHR1132_12840
    MSSA476:
    SAS1386
    Mu3:
    SAHV_1431
    Mu50:
    SAV1443
    MW2:
    MW1332
    RF122:
    SAB1308c
    ST398:
    SAPIG1442
    T0131:
    SAT0131_01531
    TCH60:
    HMPREF0772_11761
    TW20:
    SATW20_14430
    USA300_TCH1516:
    USA300HOU_1380
    VC40:
    SAVC_06470

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGKKMGLGLSIALVVIGIAVVCLMIFSSQKTTYFGYMNSNTNAEKVVSEKDGLVKHNIKV
    N315            MGKKMGLGLSIALVVIGIAVVCLMIFSSQKTTYFGYMNSKTNAEKVVSEKDGLVKHNIKV
    NCTC8325        MGKKMGLGLSIALVVIGIAVVCLMIFSSQKTTYFGYMNSNTNAEKVVSEKDGLVKHNIKV
    Newman          MGKKMGLGLSIALVVIGIAVVCLMIFSSQKTTYFGYMNSNTNAEKVVSEKDGLVKHNIKV
    USA300_FPR3757  MGKKMGLGLSIALVVIGIAVVCLMIFSSQKTTYFGYMNSNTNAEKVVSEKDGLVKHNIKV
                    ***************************************:********************

    COL             EPSNDFKPKKGGFVKLVSKDDGKTFYKQEIVKHDDVPHGLMMKIHDMHMN
    N315            EPSNDFKPKKGDFVKLVSKDDGKTFYKQEIVKHDDVPHGLMMKIHDMHMN
    NCTC8325        EPSNDFKPKKGDFVKLVSKDDGKTFYKQEIVKHDDVPHGLMMKIHDMHMN
    Newman          EPSNDFKPKKGGFVKLVSKDDGKTFYKQEIVKHDDVPHGLMMKIHDMHMN
    USA300_FPR3757  EPSNDFKPKKGDFVKLVSKDDGKTFYKQEIVKHDDVPHGLMMKIHDMHMN
                    ***********.**************************************