From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003904000
  • symbol?: gpsB
  • description?: cell cycle protein GpsB

      descriptions from strain specific annotations:

    • cell cycle protein GpsB
    • cell division initiation protein DivIVA
    • cell division protein diviva
    • cell division protein GpsB
    • Cell division protein GpsB, coordinates the switch between cylindrical and septal cell wall synthesis by re-localization of PBP1
    • divIVA family protein
  • strand?: -
  • coordinates?: 4224882..4225226
  • synteny block?: BlockID0029500
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1401 (gpsB)
    08BA02176:
    C248_1485
    11819-97:
    MS7_1402 (gpsB)
    71193:
    ST398NM01_1445
    ECT-R 2:
    ECTR2_1300
    ED133:
    SAOV_1454
    ED98:
    SAAV_1431
    HO 5096 0412:
    SAEMRSA15_13070
    JH1:
    SaurJH1_1534
    JH9:
    SaurJH9_1505
    JKD6008:
    SAA6008_01414 (gpsB)
    JKD6159:
    SAA6159_01311 (gpsB)
    LGA251:
    SARLGA251_13600
    M013:
    M013TW_1393
    MRSA252:
    SAR1457
    MSHR1132:
    SAMSHR1132_12860
    MSSA476:
    SAS1388
    Mu3:
    SAHV_1434
    Mu50:
    SAV1446
    MW2:
    MW1335
    RF122:
    SAB1310c
    ST398:
    SAPIG1445
    T0131:
    SAT0131_01534
    TCH60:
    HMPREF0772_11759 (divIVA)
    TW20:
    SATW20_14450
    USA300_TCH1516:
    USA300HOU_1383
    VC40:
    SAVC_06485

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSDVSLKLSAKDIYEKDFEKTMARGYRREEVDAFLDDIIADYQKMADMNNEVVKLSEENH
    N315            MSDVSLKLSAKDIYEKDFEKTMARGYRREEVDAFLDDIIADYQKMADMNNEVVKLSEENH
    NCTC8325        MSDVSLKLSAKDIYEKDFEKTMARGYRREEVDAFLDDIIADYQKMADMNNEVVKLSEENH
    Newman          MSDVSLKLSAKDIYEKDFEKTMARGYRREEVDAFLDDIIADYQKMADMNNEVVKLSEENH
    USA300_FPR3757  MSDVSLKLSAKDIYEKDFEKTMARGYRREEVDAFLDDIIADYQKMADMNNEVVKLSEENH
                    ************************************************************

    COL             KLKKELEELRLRVATSRPQDNKSFSSNNTTTNTSSNNVDILKRISNLEKAVFGK
    N315            KLKKELEELRLRVATSRPQDNKSFSSNNTTTNTSSNNVDILKRISNLEKAVFGK
    NCTC8325        KLKKELEELRLRVATSRPQDNKSFSSNNTTTNTSSNNVDILKRISNLEKAVFGK
    Newman          KLKKELEELRLRVATSRPQDNKSFSSNNTTTNTSSNNVDILKRISNLEKAVFGK
    USA300_FPR3757  KLKKELEELRLRVATSRPQDNKSFSSNNTTTNTSSNNVDILKRISNLEKAVFGK
                    ******************************************************