Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003905000
  • symbol?:
  • description?: protein YpsA
  • strand?: -
  • coordinates?: 4225240..4225803
  • synteny block?: BlockID0029510
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1402
    08BA02176:
    C248_1486
    11819-97:
    MS7_1403
    71193:
    ST398NM01_1446
    ECT-R 2:
    ECTR2_1301
    ED133:
    SAOV_1455
    ED98:
    SAAV_1432
    HO 5096 0412:
    SAEMRSA15_13080
    JH1:
    SaurJH1_1535
    JH9:
    SaurJH9_1506
    JKD6008:
    SAA6008_01415
    JKD6159:
    SAA6159_01312
    LGA251:
    SARLGA251_13610
    M013:
    M013TW_1394
    MRSA252:
    SAR1458
    MSHR1132:
    SAMSHR1132_12870
    MSSA476:
    SAS1389
    Mu3:
    SAHV_1435
    Mu50:
    SAV1447
    MW2:
    MW1336
    RF122:
    SAB1311c
    ST398:
    SAPIG1446
    T0131:
    SAT0131_01535
    TCH60:
    HMPREF0772_11758
    TW20:
    SATW20_14460
    USA300_TCH1516:
    USA300HOU_1384
    VC40:
    SAVC_06490

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVKTVYVTGYKSFELNIFKDDAPEVHYLKQFIKHKIEQLLDEGLEWVLIQGQMGIELWTA
    N315            MVKTVYVTGYKSFELNIFKDDAPEVHYLKQFIKHKIEQLLDEGLEWVLIQGQMGIELWTA
    NCTC8325        MVKTVYVTGYKSFELNIFKDDAPEVHYLKQFIKHKIEQLLDEGLEWVLIQGQMGIELWTA
    Newman          MVKTVYVTGYKSFELNIFKDDAPEVHYLKQFIKHKIEQLLDEGLEWVLIQGQMGIELWTA
    USA300_FPR3757  MVKTVYVTGYKSFELNIFKDDAPEVHYLKQFIKHKIEQLLDEGLEWVLIQGQMGIELWTA
                    ************************************************************

    COL             EVVIELQRTYDSLKFAVITPFQGHTEKWNEHNQSKYANIIKHADYVDSIFHTSYQGPFQF
    N315            EVVIELQRTYDSLKFAVITPFQGHTEKWNEHNQSKYANIIKHADYVDSIFHTSYQGPFQF
    NCTC8325        EVVIELQRTYDSLKFAVITPFQGHTEKWNEHNQSKYANIIKHADYVDSIFHTSYQGPFQF
    Newman          EVVIELQRTYDSLKFAVITPFQGHTEKWNEHNQSKYANIIKHADYVDSIFHTSYQGPFQF
    USA300_FPR3757  EVVIELQRTYDSLKFAVITPFQGHTEKWNEHNQSKYANIIKHADYVDSIFHTSYQGPFQF
                    ************************************************************

    COL             KQADQFMLEHSDQTLLIYDEEQEASPKFFKQMLVDFMDKTNYTCDIVTFDELTAFINDLQ
    N315            KQADQFMLEHSDQTLLIYDEEQEASPKFFKQMLVDFMDKTNYTCDIVTFDELTAFINDLQ
    NCTC8325        KQADQFMLEHSDQTLLIYDEEQEASPKFFKQMLVDFMDKTNYTCDIVTFDELTAFINDLQ
    Newman          KQADQFMLEHSDQTLLIYDEEQEASPKFFKQMLVDFMDKTNYTCDIVTFDELTAFINDLQ
    USA300_FPR3757  KQADQFMLEHSDQTLLIYDEEQEASPKFFKQMLVDFMDKTNYTCDIVTFDELTAFINDLQ
                    ************************************************************

    COL             WSEDQSF
    N315            WSEDQSF
    NCTC8325        WSEDQSF
    Newman          WSEDQSF
    USA300_FPR3757  WSEDQSF
                    *******