From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003910000
  • symbol?: pbp2
  • description?: penicillin-binding protein 2

      descriptions from strain specific annotations:

    • penicillin-binding protein 2
    • transglycosylase
    • glycosyl transferase family protein
    • Multimodular transpeptidase-transglycosylase / Penicillin-binding protein 1A/1B (PBP1)
    • PBP2
    • penicillin-binding protein 1A/1B (PBP1)
  • strand?: +
  • coordinates?: 4227346..4229499
  • synteny block?: BlockID0029560
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1490 (pbp2)
    N315:
    SA1283 (pbp2)
    NCTC8325:
    Newman:
    NWMN_1361 (pbpB)
    USA300_FPR3757:
    04-02981:
    SA2981_1406 (pbp1)
    08BA02176:
    C248_1490 (pbp2)
    11819-97:
    MS7_1406 (pbp2)
    71193:
    ST398NM01_1450
    ECT-R 2:
    ECTR2_1304
    ED133:
    SAOV_1458 (pbp2)
    ED98:
    SAAV_1437 (pbp2)
    HO 5096 0412:
    SAEMRSA15_13110 (pbp2)
    JH1:
    SaurJH1_1538
    JH9:
    SaurJH9_1509
    JKD6008:
    SAA6008_01419 (pbp2)
    JKD6159:
    SAA6159_01315 (pbp2)
    LGA251:
    SARLGA251_13640 (pbp2)
    M013:
    M013TW_1398
    MRSA252:
    SAR1461 (pbp2)
    MSHR1132:
    SAMSHR1132_12900
    MSSA476:
    SAS1393
    Mu3:
    SAHV_1438 (pbp2)
    Mu50:
    SAV1450 (pbp2)
    MW2:
    MW1340 (pbp2)
    RF122:
    SAB1314 (pbp2)
    ST398:
    SAPIG1450
    T0131:
    SAT0131_01539
    TCH60:
    HMPREF0772_11754 (pbp)
    TW20:
    SATW20_14490 (pbp2)
    USA300_TCH1516:
    USA300HOU_1388 (pbp2)
    VC40:
    SAVC_06505

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTENKGSSQPKKNGNNGGKSNSKKNRNVKRTIIKIIGFMIIAFFVVLLLGILLFAYYAWK
    N315            MTENKGSSQPKKNGNNGGKSNSKKNRNVKRTIIKIIGFMIIAFFVVLLLGILLFAYYAWK
    NCTC8325        MTENKGSSQPKKNGNNGGKSNSKKNRNVKRTIIKIIGFMIIAFFVVLLLGILLFAYYAWK
    Newman          MTENKGSSQPKKNGNNGGKSNSKKNRNVKRTIIKIIGFMIIAFFVVLLLGILLFAYYAWK
    USA300_FPR3757  MTENKGSSQPKKNGNNGGKSNSKKNRNVKRTIIKIIGFMIIAFFVVLLLGILLFAYYAWK
                    ************************************************************

    COL             APAFTEAKLQDPIPAKIYDKNGELVKTLDNGQRHEHVNLKDVPKSMKDAVLATEDNRFYE
    N315            APAFTEAKLQDPIPAKIYDKNGELVKTLDNGQRHEHVNLKDVPKSMKDAVLATEDNRFYE
    NCTC8325        APAFTEAKLQDPIPAKIYDKNGELVKTLDNGQRHEHVNLKDVPKSMKDAVLATEDNRFYE
    Newman          APAFTEAKLQDPIPAKIYDKNGELVKTLDNGQRHEHVNLKDVPKSMKDAVLATEDNRFYE
    USA300_FPR3757  APAFTEAKLQDPIPAKIYDKNGELVKTLDNGQRHEHVNLKDVPKSMKDAVLATEDNRFYE
                    ************************************************************

    COL             HGALDYKRLFGAIGKNLTGGFGSEGASTLTQQVVKDAFLSQHKSIGRKAQEAYLSYRLEQ
    N315            HGALDYKRLFGAIGKNLTGGFGSEGASTLTQQVVKDAFLSQHKSIGRKAQEAYLSYRLEQ
    NCTC8325        HGALDYKRLFGAIGKNLTGGFGSEGASTLTQQVVKDAFLSQHKSIGRKAQEAYLSYRLEQ
    Newman          HGALDYKRLFGAIGKNLTGGFGSEGASTLTQQVVKDAFLSQHKSIGRKAQEAYLSYRLEQ
    USA300_FPR3757  HGALDYKRLFGAIGKNLTGGFGSEGASTLTQQVVKDAFLSQHKSIGRKAQEAYLSYRLEQ
                    ************************************************************

    COL             EYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLPQVPNNYNIY
    N315            EYSKDDIFQVYLNKIYCSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLPQVPNNYNIY
    NCTC8325        EYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLPQVPNNYNIY
    Newman          EYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLPQVPNNYNIY
    USA300_FPR3757  EYSKDDIFQVYLNKIYYSDGVTGIKAAAKYYFNKDLKDLNLAEEAYLAGLPQVPNNYNIY
                    **************** *******************************************

    COL             DHPKAAEDRKNTVLYLMHYHKRITDKQWEDAKKIDLKANLVNRTPEERQNIDTNQDSEYN
    N315            DHPKAAEDRKNTVLYLMHYHKRITDKQWEDAKKIDLKANLVNRTPEERQNIDTNQDSEYN
    NCTC8325        DHPKAAEDRKNTVLYLMHYHKRITDKQWEDAKKIDLKANLVNRTPEERQNIDTNQDSEYN
    Newman          DHPKAAEDRKNTVLYLMHYHKRITDKQWEDAKKIDLKANLVNRTPEERQNIDTNQDSEYN
    USA300_FPR3757  DHPKAAEDRKNTVLYLMHYHKRITDKQWEDAKKIDLKANLVNRTPEERQNIDTNQDSEYN
                    ************************************************************

    COL             SYVNFVKSELMNNKAFKDENLGNVLQSGIKIYTNMDKDVQKTLQNDVDNGSFYKNKDQQV
    N315            SYVNFVKSELMNNKAFKDENLGNVLQSGIKIYTNMDKDVQKTLQNDVDNGSFYKNKDQQV
    NCTC8325        SYVNFVKSELMNNKAFKDENLGNVLQSGIKIYTNMDKDVQKTLQNDVDNGSFYKNKDQQV
    Newman          SYVNFVKSELMNNKAFKDENLGNVLQSGIKIYTNMDKDVQKTLQNDVDNGSFYKNKDQQV
    USA300_FPR3757  SYVNFVKSELMNNKAFKDENLGNVLQSGIKIYTNMDKDVQKTLQNDVDNGSFYKNKDQQV
                    ************************************************************

    COL             GATILDSKTGGLVAISGGRDFKDVVNRNQATDPHPTGSSLKPFLAYGPAIENMKWATNHA
    N315            GATILDSKTGGLVAISGGRDFKDVVNRNQATDPHPTGSSLKPFLAYGPAIENMKWATNHA
    NCTC8325        GATILDSKTGGLVAISGGRDFKDVVNRNQATDPHPTGSSLKPFLAYGPAIENMKWATNHA
    Newman          GATILDSKTGGLVAISGGRDFKDVVNRNQATDPHPTGSSLKPFLAYGPAIENMKWATNHA
    USA300_FPR3757  GATILDSKTGGLVAISGGRDFKDVVNRNQATDPHPTGSSLKPFLAYGPAIENMKWATNHA
                    ************************************************************

    COL             IQDESSYQVDGSTFRNYDTKSHGTVSIYDALRQSFNIPALKAWQSVKQNAGNDAPKKFAA
    N315            IQDESSYQVDGSTFRNYDTKSHGTVSIYDALRQSFNIPALKAWQSVKQNAGNDAPKKFAA
    NCTC8325        IQDESSYQVDGSTFRNYDTKSHGTVSIYDALRQSFNIPALKAWQSVKQNAGNDAPKKFAA
    Newman          IQDESSYQVDGSTFRNYDTKSHGTVSIYDALRQSFNIPALKAWQSVKQNAGNDAPKKFAA
    USA300_FPR3757  IQDESSYQVDGSTFRNYDTKSHGTVSIYDALRQSFNIPALKAWQSVKQNAGNDAPKKFAA
                    ************************************************************

    COL             KLGLNYEGDIGPSEVLGGSASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRDGETIEY
    N315            KLGLNYEGDIGPSEVLGGSASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRDGETIEY
    NCTC8325        KLGLNYEGDIGPSEVLGGSASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRDGETIEY
    Newman          KLGLNYEGDIGPSEVLGGSASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRDGETIEY
    USA300_FPR3757  KLGLNYEGDIGPSEVLGGSASEFSPTQLASAFAAIANGGTYNNAHSIQKVVTRDGETIEY
                    ************************************************************

    COL             DHTSHKAMSDYTAYMLAEMLKGTFKPYGSAYGHGVSGVNMGAKTGTGTYGAETYSQYNLP
    N315            DHTSHKAMSDYTAYMLAEMLKGTFKPYGSAYGHGVSGVNMGAKTGTGTYGAETYSQYNLP
    NCTC8325        DHTSHKAMSDYTAYMLAEMLKGTFKPYGSAYGHGVSGVNMGAKTGTGTYGAETYSQYNLP
    Newman          DHTSHKAMSDYTAYMLAEMLKGTFKPYGSAYGHGVSGVNMGAKTGTGTYGAETYSQYNLP
    USA300_FPR3757  DHTSHKAMSDYTAYMLAEMLKGTFKPYGSAYGHGVSGVNMGAKTGTGTYGAETYSQYNLP
                    ************************************************************

    COL             DNAAKDVWINGFTPQYTMSVWMGFSKVKQYGENSFVGHSQQEYPQFLYENVMSKISSRDG
    N315            DNAAKDVWINGFTPQYTMSVWMGFSKVKQYGENSFVGHSQQEYPQFLYENVMSKISSRDG
    NCTC8325        DNAAKDVWINGFTPQYTMSVWMGFSKVKQYGENSFVGHSQQEYPQFLYENVMSKISSRDG
    Newman          DNAAKDVWINGFTPQYTMSVWMGFSKVKQYGENSFVGHSQQEYPQFLYENVMSKISSRDG
    USA300_FPR3757  DNAAKDVWINGFTPQYTMSVWMGFSKVKQYGENSFVGHSQQEYPQFLYENVMSKISSRDG
                    ************************************************************

    COL             EDFKRPSSVSGSIPSINVSGSQDNNTTNRSTHGGSDTSANSSGTAQSNNNTRSQQSRNSG
    N315            EDFKRPSSVSGSIPSINVSGSQDNNTTNRSTHGGSDTSANSSGTAQSNNNTRSQQSRNSG
    NCTC8325        EDFKRPSSVSGSIPSINVSGSQDNNTTNRSTHGGSDTSANSSGTAQSNNNTRSQQSRNSG
    Newman          EDFKRPSSVSGSIPSINVSGSQDNNTTNRSTHGGSDTSANSSGTAQSNNNTRSQQSRNSG
    USA300_FPR3757  EDFKRPSSVSGSIPSINVSGSQDNNTTNRSTHGGSDTSANSSGTAQSNNNTRSQQSRNSG
                    ************************************************************

    COL             GLTGIFN
    N315            GLTGIFN
    NCTC8325        GLTGIFN
    Newman          GLTGIFN
    USA300_FPR3757  GLTGIFN
                    *******