From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003918000
  • symbol?: bshA
  • description?: lipopolysaccharide biosynthesis-related pr-like protein

      descriptions from strain specific annotations:

    • lipopolysaccharide biosynthesis-related pr-like protein
    • group 1 glycosyl transferase
    • glycosyl transferase, group 1 family protein
    • glycosyl transferases group 1 family protein
    • putative glycosyltransferase
    • Glycosyltransferase
    • glycosyl transferase family protein
    • N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA
  • strand?: -
  • coordinates?: 4238912..4240024
  • synteny block?: BlockID0029640
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1414
    08BA02176:
    C248_1498
    11819-97:
    MS7_1414 (bshA)
    71193:
    ST398NM01_1458
    ECT-R 2:
    ECTR2_1312
    ED133:
    SAOV_1466
    ED98:
    SAAV_1445
    HO 5096 0412:
    SAEMRSA15_13190
    JH1:
    SaurJH1_1546
    JH9:
    SaurJH9_1517
    JKD6008:
    SAA6008_01427
    JKD6159:
    SAA6159_01323
    LGA251:
    SARLGA251_13720
    M013:
    M013TW_1406
    MRSA252:
    SAR1469
    MSHR1132:
    SAMSHR1132_12980
    MSSA476:
    SAS1401
    Mu3:
    SAHV_1446
    Mu50:
    SAV1458
    MW2:
    MW1348
    RF122:
    SAB1322c
    ST398:
    SAPIG1458
    T0131:
    SAT0131_01547
    TCH60:
    HMPREF0772_11746
    TW20:
    SATW20_14570
    USA300_TCH1516:
    USA300HOU_1396
    VC40:
    SAVC_06545

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGKRMKIGITCYPSMGGSGIIATELGIELAERGHEVHFITSNIPFRIRKPLPNMIFHQVE
    N315            ----MKIGITCYPSMGGSGIIATELGIKLAERGHEVHFITSNIPFRIRKPLPNMIFHQVE
    NCTC8325        ----MKIGITCYPSMGGSGIIATELGIKLAERGHEVHFITSNIPFRIRKPLPNMIFHQVE
    Newman          ----MKIGITCYPSMGGSGIIATELGIKLAERGHEVHFITSNIPFRIRKPLPNMIFHQVE
    USA300_FPR3757  ----MKIGITCYPSMGGSGIIATELGIKLAERGHEVHFITSNIPFRIRKPLPNMIFHQVE
                        ***********************:********************************

    COL             VNQYAVFQYPPYDITLSTKIAEVIKEYDLDLLHMHYAVPHAICGILAREMSGKDIKIMTT
    N315            VNQYAVFQYPPYDITLSTKIAEVIKEYDLDLLHMHYAVPHAICGILAREMSGKDIKIMTT
    NCTC8325        VNQYAVFQYPPYDITLSTKIAEVIKEYDLDLLHMHYAVPHAICGILAREMSGKDIKIMTT
    Newman          VNQYAVFQYPPYDITLSTKIAEVIKEYDLDLLHMHYAVPHAICGILAREMSGKDIKIMTT
    USA300_FPR3757  VNQYAVFQYPPYDITLSTKIAEVIKEYDLDLLHMHYAVPHAICGILAREMSGKDIKIMTT
                    ************************************************************

    COL             LHGTDITVLGYDHSLQGAIKFGIEKSDIVTSVSKSLAQETHEIIETNKEIIPIYNFVREN
    N315            LHGTDITVLGYDHSLQGAIKFGIEKSDIVTSVSKSLAQETHEIIETNKEIIPIYNFVREN
    NCTC8325        LHGTDITVLGYDHSLQGAIKFGIEKSDIVTSVSKSLAQETHEIIETNKEIIPIYNFVREN
    Newman          LHGTDITVLGYDHSLQGAIKFGIEKSDIVTSVSKSLAQETHEIIETNKEIIPIYNFVREN
    USA300_FPR3757  LHGTDITVLGYDHSLQGAIKFGIEKSDIVTSVSKSLAQETHEIIETNKEIIPIYNFVREN
                    ************************************************************

    COL             EFPTKHNTALKSQFGIAPDEKVLIHVSNFRQVKRIDTIIETFAKVREKIPSKLILLGDGP
    N315            EFPTKHNTALKSQFGIAPDEKVLIHVSNFRQVKRIDTIIETFAKVREKIPSKLILLGDGP
    NCTC8325        EFPTKHNTALKSQFGIAPDEKVLIHVSNFRQVKRIDTIIETFAKVREKIPSKLILLGDGP
    Newman          EFPTKHNTALKSQFGIAPDEKVLIHVSNFRQVKRIDTIIETFAKVREKIPSKLILLGDGP
    USA300_FPR3757  EFPTKHNTALKSQFGIAPDEKVLIHVSNFRQVKRIDTIIETFAKVREKIPSKLILLGDGP
                    ************************************************************

    COL             ELVPMRQLTKELNVEEDVLFLGKQDCVSEFYQLSDLVLLLSEKESFGLTLLEAMKTGVVP
    N315            ELVPMRQLTKELNVEEDVLFLGKQDCVSEFYQLSDLVLLLSEKESFGLTLLEAMKTGVVP
    NCTC8325        ELVPMRQLTKELNVEEDVLFLGKQDCVSEFYQLSDLVLLLSEKESFGLTLLEAMKTGVVP
    Newman          ELVPMRQLTKELNVEEDVLFLGKQDCVSEFYQLSDLVLLLSEKESFGLTLLEAMKTGVVP
    USA300_FPR3757  ELVPMRQLTKELNVEEDVLFLGKQDCVSEFYQLSDLVLLLSEKESFGLTLLEAMKTGVVP
                    ************************************************************

    COL             IGSNAGGIKEVIKHGETGFVVDVGDCDSASDYAIRLLEDKVLYNKLQKNMLADIAERFGS
    N315            IGSNAGGIKEVIKHGETGFVVDVGDCDSASDYAIRLLEDKALYNKLQKNMLADIAERFGS
    NCTC8325        IGSNAGGIKEVIKHGETGFVVDVGDCDSASDYAIRLLEDKVLYNKLQKNMLADIAERFGS
    Newman          IGSNAGGIKEVIKHGETGFVVDVGDCDSASDYAIRLLEDKVLYNKLQKNMLADIAERFGS
    USA300_FPR3757  IGSNAGGIKEVIKHGETGFVVDVGDCDSASDYAIRLLEDKVLYNKLQKNMLADIAERFGS
                    ****************************************.*******************

    COL             ELITDQYEYYYQKMLNEHNKSKGE
    N315            ELITDQYEYYYQKMLNEHNKSKGE
    NCTC8325        ELITDQYEYYYQKMLNEHNKSKGE
    Newman          ELITDQYEYYYQKMLNEHNKSKGE
    USA300_FPR3757  ELITDQYEYYYQKMLNEHNKSKGE
                    ************************