From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003921000
  • symbol?:
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • membrane spanning protein
    • putative transmembrane protein
    • YpjA
  • strand?: -
  • coordinates?: 4242365..4242673
  • synteny block?: BlockID0029670
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1417
    08BA02176:
    C248_1501
    11819-97:
    MS7_1417
    71193:
    ST398NM01_1461
    ECT-R 2:
    ECTR2_1315
    ED133:
    SAOV_1469
    ED98:
    SAAV_1448
    HO 5096 0412:
    SAEMRSA15_13220
    JH1:
    SaurJH1_1549
    JH9:
    SaurJH9_1520
    JKD6008:
    SAA6008_01430
    JKD6159:
    SAA6159_01326
    LGA251:
    SARLGA251_13750
    M013:
    M013TW_1409
    MRSA252:
    SAR1472
    MSHR1132:
    SAMSHR1132_13010
    MSSA476:
    SAS1404
    Mu3:
    SAHV_1449
    Mu50:
    SAV1461
    MW2:
    MW1351
    RF122:
    SAB1325c
    ST398:
    SAPIG1461
    T0131:
    SAT0131_01550
    TCH60:
    HMPREF0772_11743
    TW20:
    SATW20_14600
    USA300_TCH1516:
    USA300HOU_1399
    VC40:
    SAVC_06560

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTIKAFWQYTLYQRSWLMMLLICNILGMIYGYIWYGEQLSHTPWHFKIFVPDSPTAILYL
    N315            MTINTFWQYTLYQRSWLMMLLICNILGMIYGYIWYGEQLSHTPWHFKIFVPDSPTAILYL
    NCTC8325        MTIKAFWQYTLYQRSWLMMLLICNILGMIYGYIWYGEQLSHTPWHFKIFVPDSPTAILYL
    Newman          MTIKAFWQYTLYQRSWLMMLLICNILGMIYGYIWYGEQLSHTPWHFKIFVPDSSTAILYL
    USA300_FPR3757  MTIKAFWQYTLYQRSWLMMLLICNILGMIYGYIWYGEQLSHTPWHFKIFVPDSPTAILYL
                    ***::************************************************.******

    COL             VISISLILIQKQNSIIDALAFVTLFKYGIWAVIMNILFIIEQGDITVNGLVLMFSHSIMA
    N315            VISISLILIQKQNSIIEALAFVTLFKYGIWAVIMNILFIIEQGDITVNGLVLMFSHSIMA
    NCTC8325        VISISLILIQKQNSIIDALAFVTLFKYGIWAVIMNILFIIEQGDITVNGLVLMFSHSIMA
    Newman          VISISLILIQKQNSIIDALAFVTLFKYGIWAVIMNILFIIEQGDITVNGLVLMFSHSIMA
    USA300_FPR3757  VISISLILIQKQNSIIDALAFVTLFKYGIWAVIMNILFIIEQGDITVNGLVLMFSHSIMA
                    ****************:*******************************************

    COL             VQAIYFYPRFKRSMIGISVAMIWVFLNDYIDYFHLQFPYYDFITTHVWQIGVLSCCLSVF
    N315            VQAIYFYPRFKRSMIGISVAMIWVFLNDYIDYFHLQFPYYDFITTHVWQIGVLSCCLSVF
    NCTC8325        VQAIYFYPRFKRSMIGISVAMIWVFLNDYIDYFHLQFPYYDFITTHVWQIGVLSCCLSVF
    Newman          VQAIYFYPRFKRSMIGISVAMIWVFLNDYIDYFHLQFPYYDFITTHVWQIGVLSCCLSVF
    USA300_FPR3757  VQAIYFYPRFKRSMIGISVAMIWVFLNDYIDYFHLQFPYYDFITTHVWQIGVLSCCLSVF
                    ************************************************************

    COL             GLLLYIELNKLLKCK
    N315            GLLLYIELNKLLKCK
    NCTC8325        GLLLYIELNKLLKCK
    Newman          GLLLYIELNKLLKCK
    USA300_FPR3757  GLLLYIELNKLLKCK
                    ***************