From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003929000
  • symbol?: ndk
  • description?: nucleoside diphosphate kinase

      descriptions from strain specific annotations:

    • nucleoside diphosphate kinase
    • mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-phosphodiesterase
    • nucleoside diphosphate kinase (NDK) (NDP kinase)(Nucleoside-2-P kinase)
    • nucleoside diphosphate kinase superfamily
    • putative nucleoside diphosphate kinase
  • strand?: -
  • coordinates?: 4249229..4249660
  • synteny block?: BlockID0029750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1509 (ndk)
    N315:
    SA1301 (ndk)
    NCTC8325:
    Newman:
    NWMN_1378 (ndk)
    USA300_FPR3757:
    04-02981:
    SA2981_1425 (ndk)
    08BA02176:
    C248_1508 (ndk)
    11819-97:
    MS7_1423 (ndk)
    71193:
    ST398NM01_1467
    ECT-R 2:
    ECTR2_1321
    ED133:
    SAOV_1475
    ED98:
    SAAV_1456 (ndk)
    HO 5096 0412:
    SAEMRSA15_13290 (ndk)
    JH1:
    SaurJH1_1556 (ndk)
    JH9:
    SaurJH9_1526 (ndk)
    JKD6008:
    SAA6008_01437 (ndk)
    JKD6159:
    SAA6159_01333 (ndk)
    LGA251:
    SARLGA251_13810 (ndk)
    M013:
    M013TW_1416
    MRSA252:
    SAR1478 (ndk)
    MSHR1132:
    SAMSHR1132_13080
    MSSA476:
    SAS1410 (ndk)
    Mu3:
    SAHV_1457 (ndk)
    Mu50:
    SAV1469 (ndk)
    MW2:
    MW1358 (ndk)
    RF122:
    SAB1331c (ndk)
    ST398:
    SAPIG1467
    T0131:
    SAT0131_01557 (set4nm)
    TCH60:
    HMPREF0772_11737 (ndk)
    TW20:
    SATW20_14660 (ndk)
    USA300_TCH1516:
    USA300HOU_1406 (ndk)
    VC40:
    SAVC_06595 (ndk)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYND
    N315            MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYND
    NCTC8325        ------MIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYND
    Newman          MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYND
    USA300_FPR3757  ------MIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYND
                          ******************************************************

    COL             LISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSL
    N315            LISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSL
    NCTC8325        LISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSL
    Newman          LISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSL
    USA300_FPR3757  LISFITSAPVFAMVVEGEDAVNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSL
                    ************************************************************

    COL             ESAEREINLWFNENEITSYASPRDAWLYE
    N315            ESAEREINLWFNENEITSYASPRDAWLYE
    NCTC8325        ESAEREINLWFNENEITSYASPRDAWLYE
    Newman          ESAEREINLWFNENEITSYASPRDAWLYE
    USA300_FPR3757  ESAEREINLWFNENEITSYASPRDAWLYE
                    *****************************