From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003932000
  • symbol?:
  • description?: heptaprenyl diphosphate synthase (HEPPP synthase) subunit 1 family protein

      descriptions from strain specific annotations:

    • heptaprenyl diphosphate synthase (HEPPP synthase) subunit 1 family protein
    • heptaprenyl diphosphate synthase subunit 1
    • hyothetical protein
    • heptaprenyl diphosphate synthase component I
  • strand?: -
  • coordinates?: 4251462..4252034
  • synteny block?: BlockID0029780
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1428
    08BA02176:
    C248_1511
    11819-97:
    MS7_1426
    71193:
    ST398NM01_1470
    ECT-R 2:
    ECTR2_1324
    ED133:
    SAOV_1478
    ED98:
    SAAV_1459
    HO 5096 0412:
    SAEMRSA15_13320
    JH1:
    SaurJH1_1559
    JH9:
    SaurJH9_1529
    JKD6008:
    SAA6008_01440
    JKD6159:
    SAA6159_01336
    LGA251:
    SARLGA251_13840
    M013:
    M013TW_1419
    MRSA252:
    SAR1481
    MSHR1132:
    SAMSHR1132_13110
    MSSA476:
    SAS1413
    Mu3:
    SAHV_1460
    Mu50:
    SAV1472
    MW2:
    MW1361
    RF122:
    SAB1334c
    ST398:
    SAPIG1470
    T0131:
    SAT0131_01560 (set7nm)
    TCH60:
    HMPREF0772_11734
    TW20:
    SATW20_14690
    USA300_TCH1516:
    USA300HOU_1409
    VC40:
    SAVC_06610

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             METTVSKLERQIEERLKGVSEYESININHRLGKLLDLYDIPDVAKVACLTIDTSMRHLDD
    N315            METTVSKLERQIEERLKGVSEYESININHRLGKLLDSYDIPDVAKVACLTIDTSMRHLDD
    NCTC8325        METTVSKLERQIEERLKGVSEYESININHRLGKLLDLYDIPDVAKVACLTIDTSMRHLDD
    Newman          METTVSKLERQIEERLKGVSEYESININHRLGKLLDLYDIPDVAKVACLTIDTSMRHLDD
    USA300_FPR3757  METTVSKLERQIEERLKGVSEYESININHRLGKLLDLYDIPDVAKVACLTIDTSMRHLDD
                    ************************************ ***********************

    COL             ITYNHLSKHSILIGDLISAHFYTLLAEINDLSFQNEISKAIVEINELKSSLHHQALNDYE
    N315            ITYNHLSKHSILIGDLISAHFYTLLAEINDLSFQNEISKAIVEINELKSSLHHQALNDYE
    NCTC8325        ITYNHLSKHSILIGDLISAHFYTLLAEINDLSFQNEISKAIVEINELKSSLHHQALNDYE
    Newman          ITYNHLSKHSILIGDLISAHFYTLLAEINDLSFQNEISKAIVEINELKSSLHHQALNDYE
    USA300_FPR3757  ITYNHLSKHSILIGDLISAHFYTLLAEINDLSFQNEISKAIVEINELKSSLHHQALNDYE
                    ************************************************************

    COL             ISQAIVKIETLFPYITLSHFGINIDESEIYNYLFEDMSDYYPSYFKKYNQSEVKHYLHDI
    N315            ISQAIVKIETLFPYITLSHFGINIDESEIYNYLFEDMSDYYPSYFKKYNQSEVKHYLHDI
    NCTC8325        ISQAIVKIETLFPYITLSHFGINIDESEIYNYLFEDMSDYYPSYFKKYNQSEVKHYLHDI
    Newman          ISQAIVKIETLFPYITLSHFGINIDESEIYNYLFEDMSDYYPSYFKKYNQSEVKHYLHDI
    USA300_FPR3757  ISQAIVKIETLFPYITLSHFGINIDESEIYNYLFEDMSDYYPSYFKKYNQSEVKHYLHDI
                    ************************************************************

    COL             QKSYLKSRGN
    N315            QKSYLKSRGN
    NCTC8325        QKSYLKSRGN
    Newman          QKSYLKSRGN
    USA300_FPR3757  QKSYLKSRGN
                    **********