From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003934000
  • symbol?: hup
  • description?: DNA-binding protein II

      descriptions from strain specific annotations:

    • DNA-binding protein II
    • DNA-binding protein HU
    • histone family protein DNA-binding protein
    • DNA-binding protein HBsu
    • DNA-binding protein HU 1 (DNA-binding protein II) (HB)
    • histone family protein DNA-binding protein HU
    • DNA-binding protein II HBsu
  • strand?: -
  • coordinates?: 4252465..4252737
  • synteny block?: BlockID0029800
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1513 (hup)
    N315:
    SA1305 (hu)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1429 (hu)
    08BA02176:
    C248_1512 (hup)
    11819-97:
    MS7_1427 (hup)
    71193:
    ST398NM01_1471
    ECT-R 2:
    ECTR2_1325
    ED133:
    SAOV_1479 (hup)
    ED98:
    SAAV_1460 (hup)
    HO 5096 0412:
    SAEMRSA15_13330 (hup)
    JH1:
    SaurJH1_1560
    JH9:
    SaurJH9_1530
    JKD6008:
    SAA6008_01441
    JKD6159:
    SAA6159_01337
    LGA251:
    SARLGA251_13850 (hup)
    M013:
    M013TW_1420
    MRSA252:
    SAR1482 (hup)
    MSHR1132:
    SAMSHR1132_13120
    MSSA476:
    SAS1414
    Mu3:
    SAHV_1461 (hu)
    Mu50:
    SAV1473 (hu)
    MW2:
    MW1362 (hu)
    RF122:
    SAB1335c (hup)
    ST398:
    SAPIG1471
    T0131:
    SAT0131_01561 (set8nm)
    TCH60:
    HMPREF0772_11733 (hup)
    TW20:
    SATW20_14700 (hup)
    USA300_TCH1516:
    USA300HOU_1410 (hu)
    VC40:
    SAVC_06615

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKG
    N315            MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKG
    NCTC8325        MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKG
    Newman          MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKG
    USA300_FPR3757  MNKTDLINAVAEQADLTKKEAGSAVDAVFESIQNSLAKGEKVQLIGFGNFEVRERAARKG
                    ************************************************************

    COL             RNPQTGKEIDIPASKVPAFKAGKALKDAVK
    N315            RNPQTGKEIDIPASKVPAFKAGKALKDAVK
    NCTC8325        RNPQTGKEIDIPASKVPAFKAGKALKDAVK
    Newman          RNPQTGKEIDIPASKVPAFKAGKALKDAVK
    USA300_FPR3757  RNPQTGKEIDIPASKVPAFKAGKALKDAVK
                    ******************************