From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: saupan003935000
  • symbol?: gpsA
  • description?: NAD(P)H-dependent glycerol-3-phosphate dehydrogenase

      descriptions from strain specific annotations:

    • NAD(P)H-dependent glycerol-3-phosphate dehydrogenase
    • Glycerol-3-phosphate dehydrogenase (NAD(P)+)
    • glycerol-3-phosphate dehydrogenase [NAD(P)+]
    • NAD-dependent glycerol-3-phosphate dehydrogenase family protein
    • glycerol-3-phosphate dehydrogenase [NAD(P)+] (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase) (NAD(P)H-dependentdihydroxyacetone-phosphate reductase)
  • strand?: -
  • coordinates?: 4252908..4253906
  • synteny block?: BlockID0029810
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1514 (gpsA)
    N315:
    SA1306 (gpsA)
    NCTC8325:
    Newman:
    NWMN_1383 (gpsA)
    USA300_FPR3757:
    04-02981:
    SA2981_1430 (gpsA)
    08BA02176:
    C248_1513 (gpsA)
    11819-97:
    MS7_1428
    71193:
    ST398NM01_1472
    ECT-R 2:
    ECTR2_1326
    ED133:
    SAOV_1480 (gpsA)
    ED98:
    SAAV_1461 (gpsA)
    HO 5096 0412:
    SAEMRSA15_13340 (gpsA)
    JH1:
    SaurJH1_1561 (gpsA)
    JH9:
    SaurJH9_1531 (gpsA)
    JKD6008:
    SAA6008_01442 (gpsA)
    JKD6159:
    SAA6159_01338 (gpsA)
    LGA251:
    SARLGA251_13860 (gpsA)
    M013:
    M013TW_1421
    MRSA252:
    SAR1483 (gpsA)
    MSHR1132:
    SAMSHR1132_13130
    MSSA476:
    SAS1415 (gpsA)
    Mu3:
    SAHV_1462 (gpsA)
    Mu50:
    SAV1474 (gpsA)
    MW2:
    MW1363 (gpsA)
    RF122:
    SAB1336c (gpsA)
    ST398:
    SAPIG1472
    T0131:
    SAT0131_01562 (set9nm)
    TCH60:
    HMPREF0772_11732 (gpsA)
    TW20:
    SATW20_14710 (gpsA)
    USA300_TCH1516:
    USA300HOU_1411 (gpsA)
    VC40:
    SAVC_06620 (gpsA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKITVFGMGSFGTALANVLAENGHDVLMWGKNQDAVDELNTCHTNKKYLKYAKLDVNII
    N315            MTKITVFGMGSFGTALANVLAENGHDVLMWGKNQDAVDELNTCHTNKKYLKYAKLDVNII
    NCTC8325        MTKITVFGMGSFGTALANVLAENGHDVLMWGKNQDAVDELNTCHTNKKYLKYAKLDVNII
    Newman          MTKITVFGMGSFGTALANVLAENGHDVLMWGKNQDAVDELNTCHTNKKYLKYAKLDVNII
    USA300_FPR3757  MTKITVFGMGSFGTALANVLAENGHDVLMWGKNQDAVDELNTCHTNKKYLKYAKLDVNII
                    ************************************************************

    COL             ATSDMTKAIQFADIYLMALPTKAMREVASQINDKLTSKKTFIHVAKGIENGTFKRVSEMI
    N315            ATSDMTKAIQFADIYLMALPTKAMREVATQINDKLTSKKTFIHVAKGIENGTFKRVSEMI
    NCTC8325        ATSDMTKAIQFADIYLMALPTKAMREVASQINDKLTSKKTFIHVAKGIENGTFKRVSEMI
    Newman          ATSDMTKAIQFADIYLMALPTKAMREVASQINDKLTSKKTFIHVAKGIENGTFKRVSEMI
    USA300_FPR3757  ATSDMTKAIQFADIYLMALPTKAMREVASQINDKLTSKKTFIHVAKGIENGTFKRVSEMI
                    ****************************:*******************************

    COL             EDSISPEYNAGIGVLSGPSHAEEVVVKQPTTVAASSKDKSVSKLTQDLFMNDYLRVYTND
    N315            EDSISPEYNAGIGVLSGPSHAEEVVVKQPTTVAASSKDKSVSKLTQDLFMNDYLRVYTND
    NCTC8325        EDSISPEYNAGIGVLSGPSHAEEVVVKQPTTVAASSKDKSVSKLTQDLFMNDYLRVYTND
    Newman          EDSISPEYNAGIGVLSGPSHAEEVVVKQPTTVAASSKDKSVSKLTQDLFMNDYLRVYTND
    USA300_FPR3757  EDSISPEYNAGIGVLSGPSHAEEVVVKQPTTVAASSKDKSVSKLTQDLFMNDYLRVYTND
                    ************************************************************

    COL             DLIGVELGGALKNIIAVASGIVAGIGYGDNAKAALMTRGLAEISRLGEKLGADPMTFLGL
    N315            DLIGVELGGALKNIIAVASGIVAGIGYGDNAKAALMTRGLAEISRLGEKLGADPMTFLGL
    NCTC8325        DLIGVELGGALKNIIAVASGIVAGIGYGDNAKAALMTRGLAEISRLGEKLGADPMTFLGL
    Newman          DLIGVELGGALKNIIAVASGIVAGIGYGDNAKAALMTRGLAEISRLGEKLGADPMTFLGL
    USA300_FPR3757  DLIGVELGGALKNIIAVASGIVAGIGYGDNAKAALMTRGLAEISRLGEKLGADPMTFLGL
                    ************************************************************

    COL             GGIGDLIVTCTSTHSRNFTLGYKLGQGESMDQALSEMNMVVEGIYTTKSVYHLAKEKNVD
    N315            GGIGDLIVTCISTHSRNFTLGYKLGQGESMDQALSEMNMVVEGIYTTKSVYHLAKEKNVD
    NCTC8325        GGIGDLIVTCTSTHSRNFTLGYKLGQGESMDQALSEMNMVVEGIYTTKSVYHLAKEKNVD
    Newman          GGIGDLIVTCTSTHSRNFTLGYKLGQGESMDQALSEMNMVVEGIYTTKSVYHLAKEKNVD
    USA300_FPR3757  GGIGDLIVTCTSTHSRNFTLGYKLGQGESMDQALSEMNMVVEGIYTTKSVYHLAKEKNVD
                    ********** *************************************************

    COL             MPITNALYRVLFENISVKECVKDLMERDKKSE
    N315            MPITNALYRVLFENISVKECVKDLMERDKKSE
    NCTC8325        MPITNALYRVLFENISVKECVKDLMERDKKSE
    Newman          MPITNALYRVLFENISVKECVKDLMERDKKSE
    USA300_FPR3757  MPITNALYRVLFENISVKECVKDLMERDKKSE
                    ********************************