From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003937000
  • symbol?: rpsA
  • description?: 30S ribosomal protein S1

      descriptions from strain specific annotations:

    • 30S ribosomal protein S1
    • 30S ribosomalprotein S1p
    • putative 30S ribosomal protein S1
    • putative 30S ribosomal protein S1 homolog
  • strand?: -
  • coordinates?: 4255467..4256642
  • synteny block?: BlockID0029830
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1516 (rpsA)
    N315:
    SA1308 (rpsA)
    NCTC8325:
    Newman:
    NWMN_1385 (rpsA)
    USA300_FPR3757:
    04-02981:
    SA2981_1432
    08BA02176:
    C248_1515
    11819-97:
    MS7_1430 (rpsA)
    71193:
    ST398NM01_1474
    ECT-R 2:
    ECTR2_1328
    ED133:
    SAOV_1482 (rpsA)
    ED98:
    SAAV_1463 (rpsA)
    HO 5096 0412:
    SAEMRSA15_13360
    JH1:
    SaurJH1_1563 (rpsA)
    JH9:
    SaurJH9_1533 (rpsA)
    JKD6008:
    SAA6008_01444 (rpsA)
    JKD6159:
    SAA6159_01340 (rpsA)
    LGA251:
    SARLGA251_13880
    M013:
    M013TW_1423
    MRSA252:
    SAR1485 (rpsA)
    MSHR1132:
    SAMSHR1132_13150
    MSSA476:
    SAS1417 (rpsA)
    Mu3:
    SAHV_1464 (rpsA)
    Mu50:
    SAV1476 (rpsA)
    MW2:
    MW1365 (rpsA)
    RF122:
    SAB1338c (rpsA)
    ST398:
    SAPIG1474
    T0131:
    SAT0131_01564 (hsdM)
    TCH60:
    HMPREF0772_11730 (rpsA)
    TW20:
    SATW20_14730
    USA300_TCH1516:
    USA300HOU_1413 (rpsA)
    VC40:
    SAVC_06630 (rpsA)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTEEFNESMINDIKEGDKVTGEVQQVEDKQVVVHINGGKFNGIIPISQLSTHHIDSPSEV
    N315            MTEEFNESMINDIKEGDKVTGEVQQVEDKQVVVHINGGKFNGIIPISQLSTHHIDSPSEV
    NCTC8325        MTEEFNESMINDIKEGDKVTGEVQQVEDKQVVVHINGGKFNGIIPISQLSTHHIDSPSEV
    Newman          MTEEFNESMINDIKEGDKVTGEVQQVEDKQVVVHINGGKFNGIIPISQLSTHHIDSPSEV
    USA300_FPR3757  MTEEFNESMINDIKEGDKVTGEVQQVEDKQVVVHINGGKFNGIIPISQLSTHHIDSPSEV
                    ************************************************************

    COL             VKEGDEVEAYVTKVEFDEENETGAYILSRRQLETEKSYSYLQEKLDNNEIIEAKVTEVVK
    N315            VKEGDEVEAYVTKVEFDEENETGAYILSRRQLETEKSYSYLQEKLDNNEIIEAKVTEVVK
    NCTC8325        VKEGDEVEAYVTKVEFDEENETGAYILSRRQLETEKSYSYLQEKLDNNEIIEAKVTEVVK
    Newman          VKEGDEVEAYVTKVEFDEENETGAYILSRRQLETEKSYSYLQEKLDNNEIIEAKVTEVVK
    USA300_FPR3757  VKEGDEVEAYVTKVEFDEENETGAYILSRRQLETEKSYSYLQEKLDNNEIIEAKVTEVVK
                    ************************************************************

    COL             GGLVVDVGQRGFVPASLISTDFIEDFSVFDGQTIRIKVEELDPENNRVILSRKAVEQEEN
    N315            GGLVVDVGQRGFVPASLISTDFIEDFSVFDGQTIRIKVEELDPENNRVILSRKAVEQEEN
    NCTC8325        GGLVVDVGQRGFVPASLISTDFIEDFSVFDGQTIRIKVEELDPENNRVILSRKAVEQEEN
    Newman          GGLVVDVGQRGFVPASLISTDFIEDFSVFDGQTIRIKVEELDPENNRVILSRKAVEQEEN
    USA300_FPR3757  GGLVVDVGQRGFVPASLISTDFIEDFSVFDGQTIRIKVEELDPENNRVILSRKAVEQEEN
                    ************************************************************

    COL             DAKKDQLLQSLNEGDVIDGKVARLTQFGAFIDIGGVDGLVHVSELSHEHVQTPEEVVSIG
    N315            DAKKDQLLQSLNEGDVIHGKVARLTQFGAFIDIGGVDGLVHVSELSHEHVQTPEEVVSIG
    NCTC8325        DAKKDQLLQSLNEGDVIDGKVARLTQFGAFIDIGGVDGLVHVSELSHEHVQTPEEVVSIG
    Newman          DAKKDQLLQSLNEGDVIDGKVARLTQFGAFIDIGGVDGLVHVSELSHEHVQTPEEVVSIG
    USA300_FPR3757  DAKKDQLLQSLNEGDVIDGKVARLTQFGAFIDIGGVDGLVHVSELSHEHVQTPEEVVSIG
                    *****************.******************************************

    COL             QDVKVKIKSIDRDTERISLSIKDTLPTPFENIKGQFHENDVIEGVVVRLANFGAFVEIAP
    N315            QDVKVKIKSIDRDTERISLSIKDTLPTPFENIKGQFHENDVIEGVVVRLANFGAFVEIAP
    NCTC8325        QDVKVKIKSIDRDTERISLSIKDTLPTPFENIKGQFHENDVIEGVVVRLANFGAFVEIAP
    Newman          QDVKVKIKSIDRDTERISLSIKDTLPTPFENIKGQFHENDVIEGVVVRLANFGAFVEIAP
    USA300_FPR3757  QDVKVKIKSIDRDTERISLSIKDTLPTPFENIKGQFHENDVIEGVVVRLANFGAFVEIAP
                    ************************************************************

    COL             GVQGLVHISEIAHKHIGTPGEVLEPGQQVNVKILGIDEENERVSLSIKATLPNEDVVESD
    N315            GVQGLVHISEIAHKHIGTPGEVLEPGQQVNVKILGIDEENERVSLSIKATLPNEDVVESD
    NCTC8325        GVQGLVHISEIAHKHIGTPGEVLEPGQQVNVKILGIDEENERVSLSIKATLPNEDVVESD
    Newman          GVQGLVHISEIAHKHIGTPGEVLEPGQQVNVKILGIDEENERVSLSIKATLPNEDVVESD
    USA300_FPR3757  GVQGLVHISEIAHKHIGTPGEVLEPGQQVNVKILGIDEENERVSLSIKATLPNEDVVESD
                    ************************************************************

    COL             PSTTKAYLENEEEDNPTIGDMIGDKLKNLKL
    N315            PSTTKAYLENEEEDNPTIGDMIGDKLKNLKL
    NCTC8325        PSTTKAYLENEEEDNPTIGDMIGDKLKNLKL
    Newman          PSTTKAYLENEEEDNPTIGDMIGDKLKNLKL
    USA300_FPR3757  PSTTKAYLENEEEDNPTIGDMIGDKLKNLKL
                    *******************************