From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003944000
  • symbol?:
  • description?: thioredoxin reductase-like protein

      descriptions from strain specific annotations:

    • thioredoxin reductase-like protein
    • FAD-dependent pyridine nucleotide-disulfide oxidoreductase
    • Thioredoxin reductase
    • pyridine nucleotide-disulfide oxidoreductase family protein
    • pyridine nucleotide-disulfide dehydrogenase
    • putative pyridine nucleotide-disulfideoxidoreductase
    • FAD-dependent pyridine nucleotide-disulphide oxidoreductase
    • Pyridine oxidoreductase
  • strand?: -
  • coordinates?: 4259486..4260472
  • synteny block?: BlockID0029900
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1436
    08BA02176:
    C248_1520
    11819-97:
    MS7_1433
    71193:
    ST398NM01_1478
    ECT-R 2:
    ECTR2_1331
    ED133:
    SAOV_1486
    ED98:
    SAAV_1466
    HO 5096 0412:
    SAEMRSA15_13390
    JH1:
    SaurJH1_1567
    JH9:
    SaurJH9_1536
    JKD6008:
    SAA6008_01448
    JKD6159:
    SAA6159_01343
    LGA251:
    SARLGA251_13920
    M013:
    M013TW_1426
    MRSA252:
    SAR1488
    MSHR1132:
    SAMSHR1132_13180
    MSSA476:
    SAS1420
    Mu3:
    SAHV_1468
    Mu50:
    SAV1480
    MW2:
    MW1368
    RF122:
    SAB1342c
    ST398:
    SAPIG1478
    T0131:
    SAT0131_01568
    TCH60:
    HMPREF0772_11726
    TW20:
    SATW20_14770
    USA300_TCH1516:
    USA300HOU_1417
    VC40:
    SAVC_06645

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQKVESIIIGGGPCGLSAAIEQKRKGIDTLIIEKGNVVESIYNYPTHQTFFSSSDKLSIG
    N315            MQKVESIIIGGGPCGLSAAIEQKRKGIDTLIIEKGNVVESIYNYPTHQTFFSSSDKLSIG
    NCTC8325        MQKVESIIIGGGPCGLSAAIEQKRKGIDTLIIEKGNVVESIYNYPTHQTFFSSSDKLSIG
    Newman          MQKVESIIIGGGPCGLSAAIEQKRKGIDTLIIEKGNVVESIYNYPTHQTFFSSSDKLSIG
    USA300_FPR3757  MQKVESIIIGGGPCGLSAAIEQKRKGIDTLIIEKGNVVESIYNYPTHQTFFSSSDKLSIG
                    ************************************************************

    COL             DVPFIVEESKPRRNQALVYYREVVKHHQLKVNAFEEVLTVKKMNNKFTITTTKDVYECRF
    N315            DVPFIVEESKPRRNQALVYYREVVKHHQLKVNAFEEVLTVKKMNNKFTITTTKDVYECRF
    NCTC8325        DVPFIVEESKPRRNQALVYYREVVKHHQLKVNAFEEVLTVKKMNNKFTITTTKDVYECRF
    Newman          DVPFIVEESKPRRNQALVYYREVVKHHQLKVNAFEEVLTVKKMNNKFTITTTKDVYECRF
    USA300_FPR3757  DVPFIVEESKPRRNQALVYYREVVKHHQLKVNAFEEVLTVKKMNNKFTITTTKDVYECRF
                    ************************************************************

    COL             LTIATGYYGQHNTLEVEGADLPKVFHYFKEAHPYFDQDVVIIGGKNSAIDAALELEKAGA
    N315            LTIATGYYGQHNTLEVEGADLPKVFHYFKEAHPYFDQDVVIIGGKNSAIDAALELEKAGA
    NCTC8325        LTIATGYYGQHNTLEVEGADLPKVFHYFKEAHPYFDQDVVIIGGKNSAIDAALELEKAGA
    Newman          LTIATGYYGQHNTLEVEGADLPKVFHYFKEAHPYFDQDVVIIGGKNSAIDAALELEKAGA
    USA300_FPR3757  LTIATGYYGQHNTLEVEGADLPKVFHYFKEAHPYFDQDVVIIGGKNSAIDAALELEKAGA
                    ************************************************************

    COL             NVTVLYRGGDYSPSIKPWILPNFTALVNHEKIDMEFNANVTQITEDTVTYEVNGESKTIH
    N315            NVTVLYRGGDYSPSIKPWILPNFTALVNHEKIDMEFNANVTQITEDTVTYEVNGESKTIH
    NCTC8325        NVTVLYRGGDYSPSIKPWILPNFTALVNHEKIDMEFNANVTQITEDTVTYEVNGESKTIH
    Newman          NVTVLYRGGDYSPSIKPWILPNFTALVNHEKIDMEFNANVTQITEDTVTYEVNGESKTIH
    USA300_FPR3757  NVTVLYRGGDYSPSIKPWILPNFTALVNHEKIDMEFNANVTQITEDTVTYEVNGESKTIH
                    ************************************************************

    COL             NDYVFAMIGYHPDYEFLKSVGIQINTNEFGTAPMYNKETYETNIENCYIAGVIAAGNDAN
    N315            NDYVFAMIGYHPDYEFLKSVGIQINTNEFGTAPMYNKETYETNIENCYIAGVIAAGNDAN
    NCTC8325        NDYVFAMIGYHPDYEFLKSVGIQINTNEFGTAPMYNKETYETNIENCYIAGVIAAGNDAN
    Newman          NDYVFAMIGYHPDYEFLKSVGIQINTNEFGTAPMYNKETYETNIENCYIAGVIAAGNDAN
    USA300_FPR3757  NDYVFAMIGYHPDYEFLKSVGIQINTNEFGTAPMYNKETYETNIENCYIAGVIAAGNDAN
                    ************************************************************

    COL             TIFIENGKFHGGIIAQSMLAKKQTPLES
    N315            TIFIENGKFHGGIIAQNMLAKKQTPLES
    NCTC8325        TIFIENGKFHGGIIAQSMLAKKQTPLES
    Newman          TIFIENGKFHGGIIAQSMLAKKQTPLES
    USA300_FPR3757  TIFIENGKFHGGIIAQSMLAKKQTPLES
                    ****************.***********