From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003946000
  • symbol?: ebpS
  • description?: elastin binding protein

      descriptions from strain specific annotations:

    • elastin binding protein
    • elastin-binding protein EbpS
    • cell surface elastin binding protein
    • elastin binding protein, putative
    • Halomucin
    • lysM domain protein
    • peptidoglycan-binding LysM
  • strand?: -
  • coordinates?: 4260980..4262918
  • synteny block?: BlockID0029920
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1312 (ebpS)
    NCTC8325:
    Newman:
    NWMN_1389 (ebpS)
    USA300_FPR3757:
    04-02981:
    SA2981_1437 (ebpS)
    08BA02176:
    C248_1521 (ebpS)
    11819-97:
    MS7_1434 (ebpS)
    71193:
    ST398NM01_1480
    ECT-R 2:
    ECTR2_1332
    ED133:
    SAOV_1487 (ebpS)
    ED98:
    SAAV_1468
    HO 5096 0412:
    SAEMRSA15_13400 (ebpS)
    JH1:
    SaurJH1_1568
    JH9:
    SaurJH9_1537
    JKD6008:
    SAA6008_01449 (ebpS)
    JKD6159:
    SAA6159_01344 (ebpS)
    LGA251:
    SARLGA251_13930 (ebpS)
    M013:
    M013TW_1428
    MRSA252:
    SAR1489 (ebpS)
    MSHR1132:
    SAMSHR1132_13190
    MSSA476:
    SAS1421
    Mu3:
    SAHV_1469 (ebpS)
    Mu50:
    SAV1481 (ebpS)
    MW2:
    MW1369 (ebpS)
    RF122:
    SAB1343c (ebpS)
    ST398:
    SAPIG1480
    T0131:
    SAT0131_01570
    TCH60:
    HMPREF0772_11725 (ebpS)
    TW20:
    SATW20_14780 (ebpS)
    USA300_TCH1516:
    USA300HOU_1419 (ebpS)
    VC40:
    SAVC_06650

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSNNFKDDFEKNRQSIDTNSHQDHTEDVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRR
    N315            MSNNFKDDFEKNRQSIDTNSHQDHTEDVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRR
    NCTC8325        MSNNFKDDFEKNRQSIDTNSHQDHTEDVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRR
    Newman          MSNNFKDDFEKNRQSIDTNSHQDHTEDVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRR
    USA300_FPR3757  MSNNFKDDFEKNRQSIDTNSHQDHTEDVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRR
                    ************************************************************

    COL             DLATNHNKQVHNESQTSEDNVQNEAGTIDDRQVESSHSTESQEPSHQDSTPQHEEEYYNK
    N315            DLATNHNKQVHNESQTSEDNVQNEAGTIDDRQVESSHSTESQEPSHQDSTPQHEEEYYNK
    NCTC8325        DLATNHNKQVHNESQTSEDNVQNEAGTIDDRQVESSHSTESQEPSHQDSTPQHEEEYYNK
    Newman          DLATNHNKQVHNESQTSEDNVQNEAGTIDDRQVESSHSTESQEPSHQDSTPQHEEEYYNK
    USA300_FPR3757  DLATNHNKQVHNESQTSEDNVQNEAGTIDDRQVESSHSTESQEPSHQDSTPQHEEEYYNK
                    ************************************************************

    COL             NAFAMDKSHPEPIEDNDKHDTIKNAENNTEHSTVSDKSEAEQSQQPKPYFTTGANQSETS
    N315            NAFAMDKSHPEPIEDNDKHETIKDAENNTEHSTVSDKSIAEQSQQPKPYFATGANQANTS
    NCTC8325        NAFAMDKSHPEPIEDNDKHDTIKNAENNTEHSTVSDKSEAEQSQQPKPYFTTGANQSETS
    Newman          NAFAMDKSHPEPIEDNDKHDTIKNAENNTEHSTVSDKSEAEQSQQPKPYFTTGANQSETS
    USA300_FPR3757  NAFAMDKSHPEPIEDNDKHDTIKNAENNTEHSTVSDKSEAEQSQQPKPYFTTGANQSETS
                    *******************:***:************** ***********:*****::**

    COL             KNEHDNDSVKQDQDEPKEHHNGKKAAAIGAGTAGVAGAAGAMAASKAKKHSNDAQNKSNS
    N315            KDKHDDVTVKQDKDESKDHHSGKKGAAIGAGTAGVAGAAGAMGVSKAKKHSNDAQNKSNS
    NCTC8325        KNEHDNDSVKQDQDEPKEHHNGKKAAAIGAGTAGVAGAAGAMAASKAKKHSNDAQNKSNS
    Newman          KNEHDNDSVKQDQDEPKEHHNGKKAAAIGAGTAGVAGAAGAMAASKAKKHSNDAQNKSNS
    USA300_FPR3757  KNEHDNDSVKQDQDEPKEHHNGKKAAAIGAGTAGVAGAAGAMAASKAKKHSNDAQNKSNS
                    *::**: :****:**.*:**.***.*****************..****************

    COL             GKANNSTEDKASQDKSKDHHNGKKGAAIGAGTAGLAGGAASKSASAASKPHASNNASQNH
    N315            DKSNNSTEDKASQDKSKDHHNGKKGAAIGAGTAGLAGGAASKSASAASKPHASNNASQNH
    NCTC8325        GKANNSTEDKASQDKSKDHHNGKKGAAIGAGTAGLAGGAASKSASAASKPHASNNASQNH
    Newman          GKANNSTEDKASQDKSKDHHNGKKGAAIGAGTAGLAGGAASKSASAASKPHASNNASQNH
    USA300_FPR3757  GKANNSTEDKASQDKSKDHHNGKKGAAIGAGTAGLAGGAASKSASAASKPHASNNASQNH
                    .*:*********************************************************

    COL             DEHDNHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKN
    N315            DEHDNHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKN
    NCTC8325        DEHDNHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKN
    Newman          DEHDNHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKN
    USA300_FPR3757  DEHDNHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKN
                    ************************************************************

    COL             NADESKDKDTSKDASKDKSKSTDSDKSKEDQDKATKDESDNDQNNANQANNQAQNNQNQQ
    N315            NADESKDKDTSKDASKDKSKSTDSDKSKEDQDKATKDESDNDQNNANQANNQAQNNQNQQ
    NCTC8325        NADESKDKDTSKDASKDKSKSTDSDKSKEDQDKATKDESDNDQNNANQANNQAQNNQNQQ
    Newman          NADESKDKDTSKDASKDKSKSTDSDKSKEDQDKATKDESDNDQNNANQANNQAQNNQNQQ
    USA300_FPR3757  NADESKDKDTSKDASKDKSKSTDSDKSKEDQDKATKDESDNDQNNANQANNQAQNNQNQQ
                    ************************************************************

    COL             QANQNQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNG
    N315            QANQNQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNG
    NCTC8325        QANQNQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNG
    Newman          QANQNQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNG
    USA300_FPR3757  QANQNQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNG
                    ************************************************************

    COL             QQIVIP
    N315            QQIVIP
    NCTC8325        QQIVIP
    Newman          QQIVIP
    USA300_FPR3757  QQIVIP
                    ******