From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003949000
  • symbol?: fer
  • description?: ferredoxin

      descriptions from strain specific annotations:

    • ferredoxin
    • Ferredoxin-like protein
  • strand?: +
  • coordinates?: 4265507..4265755
  • synteny block?: BlockID0029950
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1525 (fer)
    N315:
    SA1315 (fer)
    NCTC8325:
    Newman:
    NWMN_1392 (fer)
    USA300_FPR3757:
    04-02981:
    SA2981_1440 (fer)
    08BA02176:
    C248_1524
    11819-97:
    MS7_1437 (fer)
    71193:
    ST398NM01_1483
    ECT-R 2:
    ECTR2_1335
    ED133:
    SAOV_1490
    ED98:
    SAAV_1471 (fer)
    HO 5096 0412:
    SAEMRSA15_13430
    JH1:
    SaurJH1_1571
    JH9:
    SaurJH9_1540
    JKD6008:
    SAA6008_01452 (fer)
    JKD6159:
    SAA6159_01347 (fer)
    LGA251:
    SARLGA251_13960
    M013:
    M013TW_1431
    MRSA252:
    SAR1492
    MSHR1132:
    SAMSHR1132_13220
    MSSA476:
    SAS1424
    Mu3:
    SAHV_1472 (fer)
    Mu50:
    SAV1484 (fer)
    MW2:
    MW1372 (fer)
    RF122:
    SAB1346
    ST398:
    SAPIG1483
    T0131:
    SAT0131_01573 (opuCC)
    TCH60:
    HMPREF0772_11722 (fer)
    TW20:
    SATW20_14810
    USA300_TCH1516:
    USA300HOU_1422 (fer)
    VC40:
    SAVC_06665

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKYTIVDMDTCIACGACGAAAPDIYDYDDEGIAFVILDDNQGTAEVPEELYEDMEDAID
    N315            MAKYTIVDMDTCIACGACGAAAPDIYDYDDEGIAFVILDDNQGTAEVPEELYEDMEDAID
    NCTC8325        --------MDTCIACGACGAAAPDIYDYDDEGIAFVILDDNQGTAEVPEELYEDMEDAID
    Newman          MAKYTIVDMDTCIACGACGAAAPDIYDYDDEGIAFVILDDNQGTAEVPEELYEDMEDAID
    USA300_FPR3757  --------MDTCIACGACGAAAPDIYDYDDEGIAFVILDDNQGTAEVPEELYEDMEDAID
                            ****************************************************

    COL             GCPTDSIKIADESFDGDALKFE
    N315            GCPTDSIKIADESFDGDALKFE
    NCTC8325        GCPTDSIKIADESFDGDALKFE
    Newman          GCPTDSIKIADESFDGDALKFE
    USA300_FPR3757  GCPTDSIKIADESFDGDALKFE
                    **********************