From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003950000
  • symbol?: ribU
  • description?: membrane protein

      descriptions from strain specific annotations:

    • membrane protein
    • Membrane protein-like protein
    • riboflavin ECF transporter substrate-specific protein RibU
    • riboflavin transporter
    • riboflavin transporter RibU
    • Substrate-specific component RibU of riboflavin ECF transporter
  • strand?: -
  • coordinates?: 4265863..4266408
  • synteny block?: BlockID0029960
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1441 (ribU)
    08BA02176:
    C248_1525
    11819-97:
    MS7_1438 (ribU)
    71193:
    ST398NM01_1484
    ECT-R 2:
    ECTR2_1336
    ED133:
    SAOV_1491
    ED98:
    SAAV_1472
    HO 5096 0412:
    SAEMRSA15_13440
    JH1:
    SaurJH1_1572
    JH9:
    SaurJH9_1541
    JKD6008:
    SAA6008_01453
    JKD6159:
    SAA6159_01348
    LGA251:
    SARLGA251_13970
    M013:
    M013TW_1432
    MRSA252:
    SAR1493
    MSHR1132:
    SAMSHR1132_13230
    MSSA476:
    SAS1425
    Mu3:
    SAHV_1473
    Mu50:
    SAV1485
    MW2:
    MW1373
    RF122:
    SAB1347c
    ST398:
    SAPIG1484
    T0131:
    SAT0131_01574
    TCH60:
    HMPREF0772_11721
    TW20:
    SATW20_14820
    USA300_TCH1516:
    USA300HOU_1423
    VC40:
    SAVC_06670

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQQNKRLITISMLSAIAFVLTFIKFPIPFLPPYLTLDFSDVPSLLATFTFGPVAGIVVAL
    N315            MQQNKRLITISMLSAIAFVLTFIKFPIPFLPPYLTLDFSDVPSLLATFTFGPVAGIVVAL
    NCTC8325        MQQNKRLITISMLSAIAFVLTFIKFPIPFLPPYLTLDFSDVPSLLATFTFGPVAGIVVAL
    Newman          MQQNKRLITISMLSAIAFVLTFIKFPIPFLPPYLTLDFSDVPSLLATFTFGPVAGIVVAL
    USA300_FPR3757  MQQNKRLITISMLSAIAFVLTFIKFPIPFLPPYLTLDFSDVPSLLATFTFGPVAGIVVAL
                    ************************************************************

    COL             VKNLLNYLFSMGDPVGPFANFLAGASFLLTAYAIYKNKRSTKSLITGLIIATIVMTIVLS
    N315            VKNLLNYLFSMGDPVGPFANFLAGASFLLTAYAIYKNKRSTKSLITGLIIATIVMTIVLS
    NCTC8325        VKNLLNYLFSMGDPVGPFANFLAGASFLLTAYAIYKNKRSTKSLITGLIIATIVMTIVLS
    Newman          VKNLLNYLFSMGDPVGPFANFLAGASFLLTAYAIYKNKRSTKSLITGLIIATIVMTIVLS
    USA300_FPR3757  VKNLLNYLFSMGDPVGPFANFLAGASFLLTAYAIYKNKRSTKSLITGLIIATIVMTIVLS
                    ************************************************************

    COL             ILNYFVLLPLYGMIFNLADIANNLKVIIVSGIIPFNIIKGIVISIVFILLYRRLANFLKR
    N315            ILNYFVLLPLYGMIFNLADIANNLKVIIVSGIIPFNIIKGIVISIVFILLYRRLANFLKR
    NCTC8325        ILNYFVLLPLYGMIFNLADIANNLKVIIVSGIIPFNIIKGIVISIVFILLYRRLANFLKR
    Newman          ILNYFVLLPLYGMIFNLADIANNLKVIIVSGIIPFNIIKGIVISIVFILLYRRLANFLKR
    USA300_FPR3757  ILNYFVLLPLYGMIFNLADIANNLKVIIVSGIIPFNIIKGIVISIVFILLYRRLANFLKR
                    ************************************************************

    COL             I
    N315            I
    NCTC8325        I
    Newman          I
    USA300_FPR3757  I
                    *