From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004026000
  • symbol?: rluB
  • description?: ribosomal large subunit pseudouridine synthase B

      descriptions from strain specific annotations:

    • ribosomal large subunit pseudouridine synthase B
    • rRNA pseudouridine synthase
    • Pseudouridine synthase
    • ribosomal large subunit pseudouridine synthase B (rRNA-uridine isomerase B) (rRNA pseudouridylate synthase B)
    • ribosomal large subunit pseudouridine synthase B, RluB
  • strand?: -
  • coordinates?: 4317295..4318032
  • synteny block?: BlockID0030630
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1536 (rluB)
    N315:
    SA1324 (rluB)
    NCTC8325:
    Newman:
    NWMN_1401 (rluB)
    USA300_FPR3757:
    04-02981:
    SA2981_1450 (rluB)
    08BA02176:
    C248_1533 (rluB)
    11819-97:
    MS7_1510 (rluB)
    71193:
    ST398NM01_1559
    ECT-R 2:
    ECTR2_1344
    ED133:
    SAOV_1495
    ED98:
    SAAV_1483 (rluB)
    HO 5096 0412:
    SAEMRSA15_14150 (rluB)
    JH1:
    SaurJH1_1581
    JH9:
    SaurJH9_1550
    JKD6008:
    SAA6008_01463 (rluB)
    JKD6159:
    SAA6159_01422 (rluB)
    LGA251:
    SARLGA251_14010 (rluB)
    M013:
    M013TW_1507
    MRSA252:
    SAR1569 (rluB)
    MSHR1132:
    SAMSHR1132_13320
    MSSA476:
    SAS1433
    Mu3:
    SAHV_1481 (rluB)
    Mu50:
    SAV1493 (rluB)
    MW2:
    MW1447 (rluB)
    RF122:
    SAB1354c (rluB)
    ST398:
    SAPIG1559 (rluB)
    T0131:
    SAT0131_01586
    TCH60:
    HMPREF0772_11648 (rluB)
    TW20:
    SATW20_14910 (rluB)
    USA300_TCH1516:
    USA300HOU_1495 (rluB)
    VC40:
    SAVC_06715

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKELERLQKRIANSGYTSRRKAETLISEGKVKVNGTTVTELGTKVKPSDTIEVEGIKIE
    N315            MTKELERLQKRIANSGYTSRRKAETLISEGKVKVNGTTVTELGTKVKPSDTIEVEGIKIE
    NCTC8325        MTKELERLQKRIANSGYTSRRKAETLISEGKVKVNGTTVTELGTKVKPSDTIEVEGIKIE
    Newman          MTKELERLQKRIANSGYTSRRKAETLISEGKVKVNGTTVTELGTKVKPSDTIEVEGIKIE
    USA300_FPR3757  MTKELERLQKRIANSGYTSRRKAETLISEGKVKVNGTTVTELGTKVKPSDTIEVEGIKIE
                    ************************************************************

    COL             LEDKIYILFHKPTQVITSVSDDRGRTVVTDYFKDIEARIYPVGRLDYDTSGLLLLTNDGE
    N315            LEDKIYILFHKPTQVITSVSDDRGRTVVTDYFKDIEARIYPVGRLDYDTSGLLLLTNDGE
    NCTC8325        LEDKIYILFHKPTQVITSVSDDRGRTVVTDYFKDIEARIYPVGRLDYDTSGLLLLTNDGE
    Newman          LEDKIYILFHKPTQVITSVSDDRGRTVVTDYFKDIEARIYPVGRLDYDTSGLLLLTNDGE
    USA300_FPR3757  LEDKIYILFHKPTQVITSVSDDRGRTVVTDYFKDIEARIYPVGRLDYDTSGLLLLTNDGE
                    ************************************************************

    COL             FTNLMTHPRYQIKKKYVAKLKGYLMREEVKALEKGIELEDGMTQPAEVKVKKQDKDKNTT
    N315            FTNLMTHPRYQIKKKYVAKLKGYLMREEVKALEKGIELEDGMTQPAEVKVKKQDKDKNTT
    NCTC8325        FTNLMTHPRYQIKKKYVAKLKGYLMREEVKALEKGIELEDGMTQPAEVKVKKQDKDKNTT
    Newman          FTNLMTHPRYQIKKKYVAKLKGYLMREEVKALEKGIELEDGMTQPAEVKVKKQDKDKNTT
    USA300_FPR3757  FTNLMTHPRYQIKKKYVAKLKGYLMREEVKALEKGIELEDGMTQPAEVKVKKQDKDKNTT
                    ************************************************************

    COL             LVEITITEGRNRQVRRMFEHFGHQVTKLSRIEYGPLNVVGLNAGEGRVLTPHEVKVMRHL
    N315            LVEITITEGRNRQVRRMFEHFGHQVTKLSRIEYGPLNVVGLNAGEGRVLTPHEVKVMRHL
    NCTC8325        LVEITITEGRNRQVRRMFEHFGHQVTKLSRIEYGPLNVVGLNAGEGRVLTPHEVKVMRHL
    Newman          LVEITITEGRNRQVRRMFEHFGHQVTKLSRIEYGPLNVVGLNAGEGRVLTPHEVKVMRHL
    USA300_FPR3757  LVEITITEGRNRQVRRMFEHFGHQVTKLSRIEYGPLNVVGLNAGEGRVLTPHEVKVMRHL
                    ************************************************************

    COL             AEHGK
    N315            AEHGK
    NCTC8325        AEHGK
    Newman          AEHGK
    USA300_FPR3757  AEHGK
                    *****