From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004028000
  • symbol?: scpA
  • description?: segregation and condensation protein A

      descriptions from strain specific annotations:

    • segregation and condensation protein A
    • chromosome segregation and condensation protein ScpA
    • ScpA/B protein
  • strand?: -
  • coordinates?: 4318560..4319291
  • synteny block?: BlockID0030650
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1538 (scpA)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1452
    08BA02176:
    C248_1535
    11819-97:
    MS7_1512 (scpA)
    71193:
    ST398NM01_1561
    ECT-R 2:
    ECTR2_1346
    ED133:
    SAOV_1497
    ED98:
    SAAV_1485 (scpA)
    HO 5096 0412:
    SAEMRSA15_14170
    JH1:
    SaurJH1_1583
    JH9:
    SaurJH9_1552
    JKD6008:
    SAA6008_01465 (scpA)
    JKD6159:
    SAA6159_01424 (scpA)
    LGA251:
    SARLGA251_14030
    M013:
    M013TW_1509
    MRSA252:
    SAR1571
    MSHR1132:
    SAMSHR1132_13340
    MSSA476:
    SAS1435
    Mu3:
    SAHV_1483
    Mu50:
    SAV1495
    MW2:
    MW1449
    RF122:
    SAB1356c
    ST398:
    SAPIG1561
    T0131:
    SAT0131_01588
    TCH60:
    HMPREF0772_11646 (scpA)
    TW20:
    SATW20_14930
    USA300_TCH1516:
    USA300HOU_1496 (scpA)
    VC40:
    SAVC_06725

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             --------MYEVKLDAFNGPLDLLLHLIQKFEIDIYDIPMQALTEQYMQYVHAMKQLEIN
    N315            MTQYEVDIMYEVKLDAFNGPLDLLLHLIQKFEIDIYDIPMQALTEQYMQYVHAMKQLEIN
    NCTC8325        --------MYEVKLDAFNGPLDLLLHLIQKFEIDIYDIPMQALTEQYMQYVHAMKQLEIN
    Newman          MTQYEVDIMYEVKLDAFNGPLDLLLHLIQKFEIDIYDIPMQALTEQYMQYVHAMKQLEIN
    USA300_FPR3757  --------MYEVKLDAFNGPLDLLLHLIQKFEIDIYDIPMQALTEQYMQYVHAMKQLEIN
                            ****************************************************

    COL             IASEYLVLASELLMIKSKMLLPQSTSDMDVDDDPREDLVGRLIEYQNYKEYTAILNDMKE
    N315            IASEYLVLASELLMIKSKMLLPQSTSDMDVDDDPREDLVGRLIEYQNYKEYTAILNDMKE
    NCTC8325        IASEYLVLASELLMIKSKMLLPQSTSDMDVDDDPREDLVGRLIEYQNYKEYTAILNDMKE
    Newman          IASEYLVLASELLMIKSKMLLPQSTSDMDVDDDPREDLVGRLIEYQNYKEYTAILNDMKE
    USA300_FPR3757  IASEYLVLASELLMIKSKMLLPQSTSDMDVDDDPREDLVGRLIEYQNYKEYTAILNDMKE
                    ************************************************************

    COL             ERDFYFTKRPTDLSHLETDESWDPNHTIDLTELIVAYQRVKNRVELNTPKSVEIRKETFT
    N315            ERDFYFTKRPTDLSHLETDESWDPNHTIDLTELIVAYQRVKNRVELNTPKSVEIRKETFT
    NCTC8325        ERDFYFTKRPTDLSHLETDESWDPNHTIDLTELIVAYQRVKNRVELNTPKSVEIRKETFT
    Newman          ERDFYFTKRPTDLSHLETDESWDPNHTIDLTELIVAYQRVKNRVELNTPKSVEIRKETFT
    USA300_FPR3757  ERDFYFTKRPTDLSHLETDESWDPNHTIDLTELIVAYQRVKNRVELNTPKSVEIRKETFT
                    ************************************************************

    COL             IQQATEQVTSRLKDKDHFNFFSLFTFSEPIEQVVTHFLAILEMSKAGIINIEQQRNFEDI
    N315            IQQATEQVTSRLKDKDHFNFFSLFTFSEPIEQVVTHFLAILEMSKAGIINIEQQRNFEDI
    NCTC8325        IQQATEQVTSRLKDKDHFNFFSLFTFSEPIEQVVTHFLAILEMSKAGIINIEQQRNFEDI
    Newman          IQQATEQVTSRLKDKDHFNFFSLFTFSEPIEQVVTHFLAILEMSKAGIINIEQQRNFEDI
    USA300_FPR3757  IQQATEQVTSRLKDKDHFNFFSLFTFSEPIEQVVTHFLAILEMSKAGIINIEQQRNFEDI
                    ************************************************************

    COL             NIIRGVNYHFG
    N315            NIIRGVNYHFG
    NCTC8325        NIIRGVNYHFG
    Newman          NIIRGVNYHFG
    USA300_FPR3757  NIIRGVNYHFG
                    ***********