From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004034000
  • symbol?:
  • description?: hypothetical protein
  • strand?: -
  • coordinates?: 4323311..4323559
  • synteny block?: BlockID0030710
  • occurrence?: in 91% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1458
    08BA02176:
    C248_1541
    11819-97:
    MS7_1518
    71193:
    ST398NM01_1567
    ECT-R 2:
    ECTR2_1352
    ED133:
    SAOV_1503
    ED98:
    SAAV_1491
    HO 5096 0412:
    SAEMRSA15_14230
    JH1:
    SaurJH1_1589
    JH9:
    SaurJH9_1558
    JKD6008:
    JKD6159:
    SAA6159_01430
    LGA251:
    SARLGA251_14090
    M013:
    M013TW_1515
    MRSA252:
    SAR1577
    MSHR1132:
    SAMSHR1132_13400
    MSSA476:
    SAS1441
    Mu3:
    SAHV_1489
    Mu50:
    SAV1501
    MW2:
    MW1455
    RF122:
    SAB1362c
    ST398:
    SAPIG1567
    T0131:
    SAT0131_01594
    TCH60:
    HMPREF0772_11640
    TW20:
    SATW20_14990
    USA300_TCH1516:
    USA300HOU_1502
    VC40:
    SAVC_06755

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNCQSESVVRLCVRYAEQLSVFEEFTVLDILGDISVDQISDGTLYYTCEKFKLLVLQGNV
    N315            MNCQSESVVRLCVRYAEQLSVFEEFTVLDILGDISVDQISDGTLYYTCEKFKLLVLQGNV
    NCTC8325        MNCQSESVVRLCVRYAEQLSVFEEFTVLDILGDISVDQISDGTLYYTCEKFKLLVLQGNV
                    ************************************************************

    COL             LGVQIITNNDESTCEVKYRKMF
    N315            LGVQIITNNDESTCEVKYRKMF
    NCTC8325        LGVQIITNNDESTCEVKYRKMF
                    **********************