From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004082000
  • symbol?: accB
  • description?: acetyl-CoA carboxylase biotin carboxyl carrier protein subunit

      descriptions from strain specific annotations:

    • acetyl-CoA carboxylase biotin carboxyl carrier protein subunit
    • acetyl-CoA carboxylase, biotin carboxyl carrier protein
    • acetyl-CoA carboxylase biotin carboxyl carrier subunit
    • biotin carboxyl carrier protein of acetyl-CoAcarboxylase
  • strand?: -
  • coordinates?: 4363226..4363690
  • synteny block?: BlockID0031140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1572 (accB)
    N315:
    SA1358 (accB)
    NCTC8325:
    Newman:
    NWMN_1432 (accB)
    USA300_FPR3757:
    04-02981:
    SA2981_1486 (accB)
    08BA02176:
    C248_1570 (accB)
    11819-97:
    MS7_1545 (accB)
    71193:
    ST398NM01_1593
    ECT-R 2:
    ECTR2_1379 (accB)
    ED133:
    SAOV_1528 (accB)
    ED98:
    SAAV_1520 (accB)
    HO 5096 0412:
    SAEMRSA15_14480 (accB)
    JH1:
    SaurJH1_1619
    JH9:
    SaurJH9_1586
    JKD6008:
    SAA6008_01497 (accB)
    JKD6159:
    SAA6159_01463 (accB)
    LGA251:
    SARLGA251_14340 (accB)
    M013:
    M013TW_1543
    MRSA252:
    SAR1605 (accB)
    MSHR1132:
    SAMSHR1132_13680
    MSSA476:
    SAS1466
    Mu3:
    SAHV_1515 (accB)
    Mu50:
    SAV1527 (accB)
    MW2:
    MW1480 (accB)
    RF122:
    SAB1400c (accB)
    ST398:
    SAPIG1593 (accB)
    T0131:
    SAT0131_01621
    TCH60:
    HMPREF0772_11613 (accB2)
    TW20:
    SATW20_15240 (accB)
    USA300_TCH1516:
    USA300HOU_1529 (accB)
    VC40:
    SAVC_06885

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNFKEIKELIEILDKSTLTEINIEDTKGKVTLKKEKETEIITPQISQMPVEAAAMPMPQA
    N315            MNFKEIKELIEILDKSTLTEINIEDTKGKVTLKKEKETEIITPQISQMPVEAAAMPMPQA
    NCTC8325        MNFKEIKELIEILDKSTLTEINIEDTKGKVTLKKEKETEIITPQISQMPVEAAAMPMPQA
    Newman          MNFKEIKELIEILDKSTLTEINIEDTKGKVTLKKEKETEIITPQISQMPVEAAAMPMPQA
    USA300_FPR3757  MNFKEIKELIEILDKSTLTEINIEDTKGKVTLKKEKETEIITPQISQMPVEAAAMPMPQA
                    ************************************************************

    COL             QSTDSNKTEAPKPTSDNHKTINAPMVGTFYKSPSPDEEAYVQVGDTVSNETTVCILEAMK
    N315            QSTDSNKTEAPKPTSDNHKTINAPMVGTFYKSPSPDEEAYVQVGDTVSNETTVCILEAMK
    NCTC8325        QSTDSNKTEAPKPTSDNHKTINAPMVGTFYKSPSPDEEAYVQVGDTVSNETTVCILEAMK
    Newman          QSTDSNKTEAPKPTSDNHKTINAPMVGTFYKSPSPDEEAYVQVGDTVSNETTVCILEAMK
    USA300_FPR3757  QSTDSNKTEAPKPTSDNHKTINAPMVGTFYKSPSPDEEAYVQVGDTVSNETTVCILEAMK
                    ************************************************************

    COL             LFNEIQAEISGEIVEILVEDGQMVEYGQPLFKVK
    N315            LFNEIQAEISGEIVEILVEDGQMVEYGQPLFKVK
    NCTC8325        LFNEIQAEISGEIVEILVEDGQMVEYGQPLFKVK
    Newman          LFNEIQAEISGEIVEILVEDGQMVEYGQPLFKVK
    USA300_FPR3757  LFNEIQAEISGEIVEILVEDGQMVEYGQPLFKVK
                    **********************************