From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004106000
  • symbol?: efp
  • description?: elongation factor P

      descriptions from strain specific annotations:

    • elongation factor P
    • Translation elongation factor P
    • protein translation elongation factor P (EF-P)
    • putative elongation factor P
    • translation elongation factor EF-P
    • Translation initiation factor 5A
  • strand?: -
  • coordinates?: 4383037..4383594
  • synteny block?: BlockID0031360
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1587 (efp)
    N315:
    NCTC8325:
    Newman:
    NWMN_1433 (efp)
    USA300_FPR3757:
    04-02981:
    SA2981_1487
    08BA02176:
    C248_1571 (efp)
    11819-97:
    MS7_1546 (efp)
    71193:
    ST398NM01_1594
    ECT-R 2:
    ECTR2_1380 (efp)
    ED133:
    SAOV_1529 (efp)
    ED98:
    SAAV_1521 (efp)
    HO 5096 0412:
    SAEMRSA15_14490 (efp)
    JH1:
    SaurJH1_1620
    JH9:
    SaurJH9_1587
    JKD6008:
    SAA6008_01498 (efp)
    JKD6159:
    SAA6159_01464 (efp)
    LGA251:
    SARLGA251_14350 (efp)
    M013:
    M013TW_1544
    MRSA252:
    SAR1606 (efp)
    MSHR1132:
    SAMSHR1132_13690
    MSSA476:
    SAS1467
    Mu3:
    SAHV_1516
    Mu50:
    SAV1528
    MW2:
    MW1481
    RF122:
    SAB1401c (efp)
    ST398:
    SAPIG1594 (efp)
    T0131:
    SAT0131_01622 (dnaX)
    TCH60:
    HMPREF0772_11612 (efp)
    TW20:
    SATW20_15250 (efp)
    USA300_TCH1516:
    USA300HOU_1530 (efp)
    VC40:
    SAVC_06890

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKV
    N315            MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKV
    NCTC8325        MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKV
    Newman          MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKV
    USA300_FPR3757  MISVNDFKTGLTISVDNAIWKVIDFQHVKPGKGSAFVRSKLRNLRTGAIQEKTFRAGEKV
                    ************************************************************

    COL             EPAMIENRRMQYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGET
    N315            EPAMIENRRMQYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGET
    NCTC8325        EPAMIENRRMQYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGET
    Newman          EPAMIENRRMQYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGET
    USA300_FPR3757  EPAMIENRRMQYLYADGDNHVFMDNESFEQTELSSDYLKEELNYLKEGMEVQIQTYEGET
                    ************************************************************

    COL             IGVELPKTVELTVTETEPGIKGDTATGATKSATVETGYTLNVPLFVNEGDVLIINTGDGS
    N315            IGVELPKTVELTVTETEPGIKGDTATGATKSATVETGYTLNVPLFVNEGDVLIINTGDGS
    NCTC8325        IGVELPKTVELTVTETEPGIKGDTATGATKSATVETGYTLNVPLFVNEGDVLIINTGDGS
    Newman          IGVELPKTVELTVTETEPGIKGDTATGATKSATVETGYTLNVPLFVNEGDVLIINTGDGS
    USA300_FPR3757  IGVELPKTVELTVTETEPGIKGDTATGATKSATVETGYTLNVPLFVNEGDVLIINTGDGS
                    ************************************************************

    COL             YISRG
    N315            YISRG
    NCTC8325        YISRG
    Newman          YISRG
    USA300_FPR3757  YISRG
                    *****