From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004110000
  • symbol?: lipM
  • description?: lipoate protein ligase

      descriptions from strain specific annotations:

    • lipoate protein ligase
    • lipoate-protein ligase A family protein
    • biotin/lipoate A/B protein ligase
    • Lipoate-protein ligase A
    • biotin/lipoate A/B protein ligase family protein
    • lipoate-protein ligase A protein
    • octanoyltransferase LipM
  • strand?: -
  • coordinates?: 4385692..4386522
  • synteny block?: BlockID0031400
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1491
    08BA02176:
    C248_1575
    11819-97:
    MS7_1550 (lipM)
    71193:
    ST398NM01_1598
    ECT-R 2:
    ECTR2_1384
    ED133:
    SAOV_1533
    ED98:
    SAAV_1525
    HO 5096 0412:
    SAEMRSA15_14530
    JH1:
    SaurJH1_1624
    JH9:
    SaurJH9_1591
    JKD6008:
    SAA6008_01502
    JKD6159:
    SAA6159_01468
    LGA251:
    SARLGA251_14390
    M013:
    M013TW_1548
    MRSA252:
    SAR1610
    MSHR1132:
    SAMSHR1132_13730
    MSSA476:
    SAS1471
    Mu3:
    SAHV_1520
    Mu50:
    SAV1533
    MW2:
    MW1485
    RF122:
    SAB1405c
    ST398:
    SAPIG1598
    T0131:
    SAT0131_01626 (recR)
    TCH60:
    HMPREF0772_11608
    TW20:
    SATW20_15290
    USA300_TCH1516:
    USA300HOU_1534
    VC40:
    SAVC_06910

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTETWNFINTGSKDPYYNMAMDEALLNFVSRGEIDPVIRFYTWNPATLSIGYFQRLQKEI
    N315            MTETWNFINTGSKDPYYNMAMDEALLNFVSRGEIDPVIRFYTWNPATLSIGYFQRLQKEI
    NCTC8325        MTETWNFINTGSKDPYYNMAMDEALLNFVSRGEIDPVIRFYTWNPATLSIGYFQRLQKEI
    Newman          MTETWNFINTGSKDPYYNMAMDEALLNFVSRGEIDPVIRFYTWNPATLSIGYFQRLQKEI
    USA300_FPR3757  MTETWNFINTGSKDPYYNMAMDEALLNFVSRGEIDPVIRFYTWNPATLSIGYFQRLQKEI
                    ************************************************************

    COL             DIDKVKEKGFGLVRRQTGGRGVLHDKELTYSVIVPESHPNMPSTVTEAYRVISQGLLEGF
    N315            DIDKVKEKGFGLVRRQTGGRGVLHDKELTYSVIVPESHPNMPSTVTEAYRVISQGLLEGF
    NCTC8325        DIDKVKEKGFGLVRRQTGGRGVLHDKELTYSVIVPESHPNMPSTVTEAYRVISQGLLEGF
    Newman          DIDKVKEKGFGLVRRQTGGRGVLHDKELTYSVIVPESHPNMPSTVTEAYRVISQGLLEGF
    USA300_FPR3757  DIDKVKEKGFGLVRRQTGGRGVLHDKELTYSVIVPESHPNMPSTVTEAYRVISQGLLEGF
                    ************************************************************

    COL             KNLGFDTYFAVPKTPEERQKLKQPRSSVCFDAPSWYELVVEGRKIAGSAQTRQKGVILQH
    N315            KNLGFDTYFAVPKTPEERQKLKQPRSSVCFDAPSWYELVVEGRKIAGSAQTRQKGVILQH
    NCTC8325        KNLGFDTYFAVPKTPEERQKLKQPRSSVCFDAPSWYELVVEGRKIAGSAQTRQKGVILQH
    Newman          KNLGFDTYFAVPKTPEERQKLKQPRSSVCFDAPSWYELVVEGRKIAGSAQTRQKGVILQH
    USA300_FPR3757  KNLGFDTYFAVPKTPEERQKLKQPRSSVCFDAPSWYELVVEGRKIAGSAQTRQKGVILQH
                    ************************************************************

    COL             GSILQDIDIDELFDMFIYKNERLKLKMKEAFVEKAVAINDISDEHITISQMEEAFEKGFK
    N315            GSILQDIDIDELFDMFIYKNERLKLKMKEAFVEKAVAINDISDEHITISQMEEAFEKGFK
    NCTC8325        GSILQDIDIDELFDMFIYKNERLKLKMKEAFVEKAVAINDISDEHITISQMEEAFEKGFK
    Newman          GSILQDIDIDELFDMFIYKNERLKLKMKEAFVEKAVAINDISDEHITISQMEEAFEKGFK
    USA300_FPR3757  GSILQDIDIDELFDMFIYKNERLKLKMKEAFVEKAVAINDISDEHITISQMEEAFEKGFK
                    ************************************************************

    COL             KGLNIELKPLELTEAQLAEVEELTEKYRSDEWMFRK
    N315            KGLNIELKPLELTEAQLAEVEELTEKYRSDEWMFRK
    NCTC8325        KGLNIELKPLELTEAQLAEVEELTEKYRSDEWMFRK
    Newman          KGLNIELKPLELTEAQLAEVEELTEKYRSDEWMFRK
    USA300_FPR3757  KGLNIEFKPLELTEAQLAEVEELTEKYRSDEWMFRK
                    ******:*****************************