From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004116000
  • symbol?: aroK
  • description?: shikimate kinase

      descriptions from strain specific annotations:

    • shikimate kinase
    • putative shikimate kinase
    • shikimate kinase, AroK
    • Shikimate kinase I
  • strand?: -
  • coordinates?: 4391667..4392191
  • synteny block?: BlockID0031460
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1596 (aroK)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1496 (aroE)
    08BA02176:
    C248_1580
    11819-97:
    MS7_1555
    71193:
    ST398NM01_1603
    ECT-R 2:
    ECTR2_1389
    ED133:
    SAOV_1538
    ED98:
    SAAV_1531 (aroK)
    HO 5096 0412:
    SAEMRSA15_14580
    JH1:
    SaurJH1_1629
    JH9:
    SaurJH9_1596
    JKD6008:
    SAA6008_01507 (aroK)
    JKD6159:
    SAA6159_01473 (aroK)
    LGA251:
    SARLGA251_14440
    M013:
    M013TW_1553
    MRSA252:
    SAR1615
    MSHR1132:
    SAMSHR1132_13780
    MSSA476:
    SAS1476
    Mu3:
    SAHV_1525
    Mu50:
    SAV1538
    MW2:
    MW1490
    RF122:
    SAB1410c
    ST398:
    SAPIG1603 (aroK)
    T0131:
    SAT0131_01631 (tmk)
    TCH60:
    HMPREF0772_11603 (aroK)
    TW20:
    SATW20_15340
    USA300_TCH1516:
    USA300HOU_1539 (aroK)
    VC40:
    SAVC_06935

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNHDKSPIILIGFMGTGKSTIGKYVADEQNLSFIDIDSYIEEKYKLTIPEIFCKHGEQYF
    N315            MNHDKSPIILIGFMGTGKSTIGKYVADEQNLSFIDIDSYIEEKYKLTIPEIFSKHGEQYF
    NCTC8325        MNHDKSPIILIGFMGTGKSTIGKYVADEQNLSFIDIDSYIEEKYKLTIPEIFCKHGEQYF
    Newman          MNHDKSPIILIGFMGTGKSTIGKYVADEQNLSFIDIDSYIEEKYKLTIPEIFCKHGEQYF
    USA300_FPR3757  MNHDKSPIILIGFMGTGKSTIGKYVADEQNLSFIDIDSYIEEKYKLTIPEIFCKHGEQYF
                    ****************************************************.*******

    COL             RNLEFTCLQECINTADIIATGGGIIESEEAFNFLKNQKNIIWLDCNIDIIYSRINDDPHR
    N315            RNLEFTCLQECINTADIIATGGGIIESEEAFNFLKNQKNIIWLDCNIDIIYSRINDDPHR
    NCTC8325        RNLEFTCLQECINTADIIATGGGIIESEEAFNFLKNQKNIIWLDCNIDIIYSRINDDPHR
    Newman          RNLEFTCLQECINTADIIATGGGIIESEEAFNFLKNQKNIIWLDCNIDIIYSRINDDPHR
    USA300_FPR3757  RNLEFTCLQECINTADIIATGGGIIESEEAFNFLKNQKNIIWLDCNIDIIYSRINDDPHR
                    ************************************************************

    COL             PNANNKTIKQLNDLYCSRNLRYNEIAFKKFDSHLLSISEIYYELLNLIKASDQY
    N315            PNANNKTIKQLNDLYCSRILRYNEIAFKKFDSHLLSISEIYYELLNLIKASDQY
    NCTC8325        PNANNKTIKQLNDLYCSRNLRYNEIAFKKFDSHLLSISEIYYELLNLIKASDQY
    Newman          PNANNKTIKQLNDLYCSRNLRYNEIAFKKFDSHLLSISEIYYELLNLIKASDQY
    USA300_FPR3757  PNANNKTIKQLNDLYCSRNLRYNEIAFKKFDSHLLSISEIYYELLNLIKASDQY
                    ****************** ***********************************