From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004136000
  • symbol?: znuB
  • description?: ABC transporter MreB

      descriptions from strain specific annotations:

    • ABC transporter MreB
    • ABC transporter permease
    • Zinc ABC transporter, inner membrane permease protein ZnuB
    • hydrophobic membrane protein ZurM
    • fecCD transport family protein
    • High-affinity zinc uptake system membrane protein
    • ABC transporter protein
    • ABC transporter ATP-binding protein
    • ABC superfamily ATP binding cassette transporter, membrane protein
    • zinc ABC superfamily ATP binding cassette transporter, membrane protein
  • strand?: -
  • coordinates?: 4404085..4404918
  • synteny block?: BlockID0031660
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1513 (znuB)
    08BA02176:
    C248_1598 (mreB)
    11819-97:
    MS7_1572
    71193:
    ST398NM01_1620
    ECT-R 2:
    ECTR2_1405
    ED133:
    SAOV_1555
    ED98:
    SAAV_1547
    HO 5096 0412:
    SAEMRSA15_14750 (mreB)
    JH1:
    SaurJH1_1647
    JH9:
    SaurJH9_1613
    JKD6008:
    SAA6008_01524 (mreB)
    JKD6159:
    SAA6159_01490 (mreB)
    LGA251:
    SARLGA251_14610 (mreB)
    M013:
    M013TW_1570
    MRSA252:
    SAR1632 (mreB)
    MSHR1132:
    SAMSHR1132_13950
    MSSA476:
    SAS1493
    Mu3:
    SAHV_1542
    Mu50:
    SAV1555
    MW2:
    MW1507
    RF122:
    SAB1427c (mreB)
    ST398:
    SAPIG1620
    T0131:
    SAT0131_01649 (spoVG)
    TCH60:
    HMPREF0772_11585 (zurM)
    TW20:
    SATW20_15510 (mreB)
    USA300_TCH1516:
    USA300HOU_1557
    VC40:
    SAVC_07025

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIDALLNFDFMRYSLISGILIGFIAPLIGAFIVVRRLSLIADALSHVTLGGISFGMFLLT
    N315            MIDALLNFDFMRYSLISGILIGFIAPLIGAFIVVRRLSLIADALSHVTLGGISFGMFLLT
    NCTC8325        MIDALLNFDFMRYSLISGILIGFIAPLIGAFIVVRRLSLIADALSHVTLGGISFGMFLLT
    Newman          MIDALLNFDFMRYSLISGILIGFIAPLIGAFIVVRRLSLIADALSHVTLGGISFGMFLLT
    USA300_FPR3757  MIDALLNFDFMRYSLISGILIGFIAPLIGAFIVVRRLSLIADALSHVTLGGISFGMFLLT
                    ************************************************************

    COL             IMPTLVFINPMWFGILFAIVGALLIEKLRTSYTAYQEIAIPIIMSAGIALSAIFISLADG
    N315            IMPTLVFINPMWFGILFAIVGALLIEKLRTSYTAYQEIAIPIIMSAGIALSAIFISLADG
    NCTC8325        IMPTLVFINPMWFGILFAIVGALLIEKLRTSYTAYQEIAIPIIMSAGIALSAIFISLADG
    Newman          IMPTLVFINPMWFGILFAIVGALLIEKLRTSYTAYQEIAIPIIMSAGIALSAIFISLADG
    USA300_FPR3757  IMPTLVFINPMWFGILFAIVGALLIEKLRTSYTAYQEIAIPIIMSAGIALSAIFISLADG
                    ************************************************************

    COL             FNQEIVGLLFGSISAVNISDLTTIIVIAIIVVLFITLFYKELFILSFDEEYSKVIGIPKW
    N315            FNQEIVGLLFGSISAVNISDLTTIIVIAIIVVLFITLFYKELFILSFDEEYSKVIGIHKW
    NCTC8325        FNQEIVGLLFGSISAVNISDLTTIIVIAIIVVLFITLFYKELFILSFDEEYSKVIGIPKW
    Newman          FNQEIVGLLFGSISAVNISDLTTIIVIAIIVVLFITLFYKELFILSFDEEYSKVIGIPKW
    USA300_FPR3757  FNQEIVGLLFGSISAVNISDLTTIIVIAIIVVLFITLFYKELFILSFDEEYSKVIGIPKW
                    ********************************************************* **

    COL             IQFLFIVIVAMVISASMRVVGILLVSALITLPIAISMRITKSFKQLILLSVFLGELSVIL
    N315            IQFLFIVIVAMVISASMRVVGILLVSALITLPIAISMRITKSFKQLILLSVFLGELSVIL
    NCTC8325        IQFLFIVIVAMVISASMRVVGILLVSALITLPIAISMRITKSFKQLILLSVFLGELSVIL
    Newman          IQFLFIVIVAMVISASMRVVGILLVSALITLPIAISMRITKSFKQLILLSVFLGELSVIL
    USA300_FPR3757  IQFLFIVIVAMVISASMRVVGILLVSALITLPIAISMRITKSFKQLILLSVFLGELSVIL
                    ************************************************************

    COL             GLVLAFYMDISPGGVIVVLLVILLMITMAYQKMRMKFKKGANINEYK
    N315            GLVLAFYMDISPGGVIVVLLVILLMITMAYQKMRMKFKKGANINEYK
    NCTC8325        GLVLAFYMDISPGGVIVVLLVILLMITMAYQKMRMKFKKGANINEYK
    Newman          GLVLAFYMDISPGGVIVVLLVILLMITMAYQKMRMKFKKGANINEYK
    USA300_FPR3757  GLVLAFYMDISPGGVIVVLLVILLMITMAYQKMRMKFKKGANINEYK
                    ***********************************************