From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004139000
  • symbol?: cshB
  • description?: DEAD/DEAH box family ATP-dependent RNA helicase

      descriptions from strain specific annotations:

    • DEAD/DEAH box family ATP-dependent RNA helicase
    • DEAD/DEAH box helicase
    • ATP-dependent RNA helicase DEAD/DEAH box family protein
    • DEAD-box ATP dependent DNA helicase
    • ATP-dependent RNA helicase YqfR
    • putative helicase
  • strand?: -
  • coordinates?: 4406782..4408147
  • synteny block?: BlockID0031690
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1516 (yqfR)
    08BA02176:
    C248_1601
    11819-97:
    MS7_1575 (cshB)
    71193:
    ST398NM01_1623
    ECT-R 2:
    ECTR2_1408
    ED133:
    SAOV_1558
    ED98:
    SAAV_1550
    HO 5096 0412:
    SAEMRSA15_14780
    JH1:
    SaurJH1_1650
    JH9:
    SaurJH9_1616
    JKD6008:
    SAA6008_01527
    JKD6159:
    SAA6159_01493
    LGA251:
    SARLGA251_14640
    M013:
    M013TW_1573
    MRSA252:
    SAR1635
    MSHR1132:
    SAMSHR1132_13980
    MSSA476:
    SAS1496
    Mu3:
    SAHV_1545
    Mu50:
    SAV1558
    MW2:
    MW1510
    RF122:
    SAB1430c
    ST398:
    SAPIG1623
    T0131:
    SAT0131_01652
    TCH60:
    HMPREF0772_11582
    TW20:
    SATW20_15540
    USA300_TCH1516:
    USA300HOU_1560
    VC40:
    SAVC_07040

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MAKHPFEQFNLESSLIDAVKDLNFEKPTEIQNRIIPRILKRTNLIGQSQTGTGKSHAFLL
    N315            MAKHPFEQFNLESSLIDAVKDLNFEKPTEIQNRIIPRILKRTNLIGQSQTGTGKSHAFLL
    NCTC8325        MAKHPFEQFNLESSLIDAVKDLNFEKPTEIQNRIIPRILKRTNLIGQSQTGTGKSHAFLL
    Newman          MAKHPFEQFNLESSLIDAVKDLNFEKPTEIQNRIIPRILKRTNLIGQSQTGTGKSHAFLL
    USA300_FPR3757  MAKHPFEQFNLESSLIDAVKDLNFEKPTEIQNRIIPRILKRTNLIGQSQTGTGKSHAFLL
                    ************************************************************

    COL             PLMQLIDSEIKEPQAIVVAPTRELAQQLYDAANHLSQFKAGVSVKVFIGGTDIEKDRQRC
    N315            PLMQLIDSEIKEPQAIVVAPTRELAQQLYDAANHLSQFKAGVSVKVFIGGTDIEKDRQRC
    NCTC8325        PLMQLIDSEIKEPQAIVVAPTRELAQQLYDAANHLSQFKAGVSVKVFIGGTDIEKDRQRC
    Newman          PLMQLIDSEIKEPQAIVVAPTRELAQQLYDAANHLSQFKAGVSVKVFIGGTDIEKDRQRC
    USA300_FPR3757  PLMQLIDSEIKEPQAIVVAPTRELAQQLYDAANHLSQFKAGVSVKVFIGGTDIEKDRQRC
                    ************************************************************

    COL             NAQPQLIIGTPTRINDLAKTGHLHVHLASYLVIDEADLMIDLGLIEDVDYIAARLEDNAN
    N315            NAQPQLIIGTPTRINDLAKTGHLHVHLASYLVIDEADLMIDLGLIEDVDYIAARLEDNAN
    NCTC8325        NAQPQLIIGTPTRINDLAKTGHLHVHLASYLVIDEADLMIDLGLIEDVDYIAARLEDNAN
    Newman          NAQPQLIIGTPTRINDLAKTGHLHVHLASYLVIDEADLMIDLGLIEDVDYIAARLEDNAN
    USA300_FPR3757  NAQPQLIIGTPTRINDLAKTGHLHVHLASYLVIDEADLMIDLGLIEDVDYIAARLEDNAN
                    ************************************************************

    COL             IAVFSATIPQQLQPFLNKYLSHPEYVAVDSKKQNKKNIEFYLIPTKGAAKVEKTLNLIDI
    N315            IAVFSATIPQQLQPFLNKYLSHPEYVAVDSKKQNKKNIEFFLIPTKGAAKVEKTLNLIDI
    NCTC8325        IAVFSATIPQQLQPFLNKYLSHPEYVAVDSKKQNKKNIEFYLIPTKGAAKVEKTLNLIDI
    Newman          IAVFSATIPQQLQPFLNKYLSHPEYVAVDSKKQNKKNIEFYLIPTKGAAKVEKTLNLIDI
    USA300_FPR3757  IAVFSATIPQQLQPFLNKYLSHPEYVAVDSKKQNKKNIEFYLIPTKGAAKVEKTLNLIDI
                    ****************************************:*******************

    COL             LNPYLCIIFCNSRDNANDLARSLNEAGIKVGMIHGGLTPRERKQQMKRIRNLEFQYVIAS
    N315            LNPYLCIIFCNSRDNANDLARSLNEAGIKVGMIHGGLTPRERKQQMKRIRNLEFQYVIAS
    NCTC8325        LNPYLCIIFCNSRDNANDLARSLNEAGIKVGMIHGGLTPRERKQQMKRIRNLEFQYVIAS
    Newman          LNPYLCIIFCNSRDNANDLARSLNEAGIKVGMIHGGLTPRERKQQMKRIRNLEFQYVIAS
    USA300_FPR3757  LNPYLCIIFCNSRDNANDLARSLNEAGIKVGMIHGGLTPRERKQQMKRIRNLEFQYVIAS
                    ************************************************************

    COL             DLASRGIDIEGVSHVINFDVPNDIDFFTHRVGRTGRGNYKGVAITLYSPDEEHNISLIED
    N315            DLASRGIDIEGVSHVINFDVPNDIDFFTHRVGRTGRGNYKGVAITLYSPDEEHNISLIED
    NCTC8325        DLASRGIDIEGVSHVINFDVPNDIDFFTHRVGRTGRGNYKGVAITLYSPDEEHNISLIED
    Newman          DLASRGIDIEGVSHVINFDVPNDIDFFTHRVGRTGRGNYKGVAITLYSPDEEHNISLIED
    USA300_FPR3757  DLASRGIDIEGVSHVINFDVPNDIDFFTHRVGRTGRGNYKGVAITLYSPDEEHNISLIED
                    ************************************************************

    COL             RGFVFNTVDIKDGELKEVKAHNQRQARMRKDDHLTNQVKNKVRSKIKNKVKPGYKKKFKQ
    N315            RGFVFNTVDIKDGELKEVKAHNQRQARMRKDDHLTNQVKDKVRSKIKNKVKPGYKKKFKQ
    NCTC8325        RGFVFNTVDIKDGELKEVKAHNQRQARMRKDDHLTNQVKNKVRSKIKNKVKPGYKKKFKQ
    Newman          RGFVFNTVDIKDGELKEVKAHNQRQARMRKDDHLTNQVKNKVRSKIKNKVKPGYKKKFKQ
    USA300_FPR3757  RGFVFNTVDIKDGELKEVKAHNQRQARMRKDDHLTNQVKNKVRSKIKNKVKPGYKKKFKQ
                    ***************************************:********************

    COL             EVEKMKRQERKQFSKQQNRQKRKQNKKG
    N315            EVEKMKRQERKQFSKQQNRQKRKQNKKG
    NCTC8325        EVEKMKRQERKQFSKQQNRQKRKQNKKG
    Newman          EVEKMKRQERKQFSKQQNRQKRKQNKKG
    USA300_FPR3757  EVEKMKRQERKQFSKQQNRQKRKQNKKG
                    ****************************