From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004155000
  • symbol?:
  • description?: Siderophore-mediated iron transport protein
  • strand?: -
  • coordinates?: 4420918..4421616
  • synteny block?: BlockID0031850
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1530
    08BA02176:
    C248_1615
    11819-97:
    MS7_1589
    71193:
    ST398NM01_1638
    ECT-R 2:
    ECTR2_1422
    ED133:
    SAOV_1572
    ED98:
    SAAV_1564
    HO 5096 0412:
    SAEMRSA15_14920
    JH1:
    SaurJH1_1664
    JH9:
    SaurJH9_1630
    JKD6008:
    SAA6008_01542
    JKD6159:
    SAA6159_01507
    LGA251:
    SARLGA251_14780
    M013:
    M013TW_1587
    MRSA252:
    SAR1649
    MSHR1132:
    SAMSHR1132_14120
    MSSA476:
    SAS1510
    Mu3:
    SAHV_1559
    Mu50:
    SAV1572
    MW2:
    MW1524
    RF122:
    SAB1444c
    ST398:
    SAPIG1638
    T0131:
    SAT0131_01668 (cysK)
    TCH60:
    HMPREF0772_11568
    TW20:
    SATW20_15680
    USA300_TCH1516:
    USA300HOU_1573
    VC40:
    SAVC_07110

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSVGILIFVISVIISIITTMRENSHKDRQNQKPPQKTSTDNEPKKGGFFEEIERTFKEIS
    N315            MSVGILIFVISVIISIITTMRENSHKDRQNQKPPQKTSTDNEPKKGGFFEEIERTFKEIS
    NCTC8325        MSVGILIFVISVIISIITTMRENSHKDRQNQKPPQKTSTDNEPKKGGFFEEIERTFKEIS
    Newman          MSVGILIFVISVIISIITTMRENSHKDRQNQKPPQKTSTDNEPKKGGFFEEIERTFKEIS
    USA300_FPR3757  MSVGILIFVISVIISIITTMRENSHKDRQNQKPPQKTSTDNEPKKGGFFEEIERTFKEIS
                    ************************************************************

    COL             EELNEEEKKSSKRKYDDTLPPLFDELPKEEPKSKPVVEPMAPKKQQETKPMTEKPITVPK
    N315            EELNEEEKKSSKRKYDDTLPPLFDELPKEEPKSKPVVEPMAPKKQPETKPMTEKPITVPK
    NCTC8325        EELNEEEKKSSKRKYDDTLPPLFDELPKEEPKSKPVVEPMAPKKQQETKPMTEKPITVPK
    Newman          EELNEEEKKSSKRKYDDTLPPLFDELPKEEPKSKPVVEPMAPKKQQETKPMTEKPITVPK
    USA300_FPR3757  EELNEEEKKSSKRKYDDTLPPLFDELPKEEPKSKPVVEPMAPKKQQETKPMTEKPITVPK
                    ********************************************* **************

    COL             AEPVEQKHRPSRQDNSDEIRRQLEKSLRDDIKTIRTDIDREKEKQIAKMEKRARDIIEDK
    N315            AEPVEQKHRPSRQDNSDEIRRQLEKSLRDDIKTIRTDIDREKEKQIAKMEKRARDIIEDK
    NCTC8325        AEPVEQKHRPSRQDNSDEIRRQLEKSLRDDIKTIRTDIDREKEKQIAKMEKRARDIIEDK
    Newman          AEPVEQKHRPSRQDNSDEIRRQLEKSLRDDIKTIRTDIDREKEKQIAKMEKRARDIIEDK
    USA300_FPR3757  AEPVEQKHRPSRQDNSDEIRRQLEKSLRDDIKTIRTDIDREKEKQIAKMEKRARDIIEDK
                    ************************************************************

    COL             YLSERTKRLKLKQLLNSQNVEKDLTKSAFQFDKDEVINGMIWSEILAKPKQL
    N315            YLSERTKRLKLKQLLNSQNVEKDLTKSAFQFDKDEVINGMIWSEILAKPKQL
    NCTC8325        YLSERTKRLKLKQLLNSQNVEKDLTKSAFQFDKDEVINGMIWSEILAKPKQL
    Newman          YLSERTKRLKLKQLLNSQNVEKDLTKSAFQFDKDEVINGMIWSEILAKPKQL
    USA300_FPR3757  YLSERTKRLKLKQLLNSQNVEKDLTKSAFQFDKDEVINGMIWSEILAKPKQL
                    ****************************************************