From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004159000
  • symbol?: mtaB
  • description?: RNA modification protein

      descriptions from strain specific annotations:

    • RNA modification protein
    • MiaB family protein, possibly involved in tRNA or rRNA modification
    • RNA modification enzyme, MiaB family protein
    • radical SAM methylthiotransferase, MiaB/RimO family protein
    • radical SAM domain-containing protein
    • MiaB family RNA modification protein
    • tRNA 2-methylthioadenosine synthase-like protein
    • Adenine synthetase
    • tRNA-I(6)A37 thiotransferase enzyme MiaB
  • strand?: -
  • coordinates?: 4424134..4425480
  • synteny block?: BlockID0031890
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1534
    08BA02176:
    C248_1619
    11819-97:
    MS7_1593
    71193:
    ST398NM01_1642
    ECT-R 2:
    ECTR2_1426
    ED133:
    SAOV_1576
    ED98:
    SAAV_1568
    HO 5096 0412:
    SAEMRSA15_14960
    JH1:
    SaurJH1_1668
    JH9:
    SaurJH9_1634
    JKD6008:
    SAA6008_01546
    JKD6159:
    SAA6159_01511
    LGA251:
    SARLGA251_14820
    M013:
    M013TW_1591
    MRSA252:
    SAR1653
    MSHR1132:
    SAMSHR1132_14160
    MSSA476:
    SAS1514
    Mu3:
    SAHV_1563
    Mu50:
    SAV1576
    MW2:
    MW1528
    RF122:
    SAB1448c
    ST398:
    SAPIG1642
    T0131:
    SAT0131_01672 (lysS)
    TCH60:
    HMPREF0772_11564 (miaB)
    TW20:
    SATW20_15720
    USA300_TCH1516:
    USA300HOU_1577
    VC40:
    SAVC_07130

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSTVAFHTLGCKVNHYETEAIWQLFKEANYERVDFEANADVFVINTCTVTNTGDKKSRQI
    N315            MSTVAFHTLGCKVNHYETEAIWQLFKEANYERVDFEANADVFVINTCTVTNTGDKKSRQI
    NCTC8325        MSTVAFHTLGCKVNHYETEAIWQLFKEANYERVDFEANADVFVINTCTVTNTGDKKSRQI
    Newman          MSTVAFHTLGCKVNHYETEAIWQLFKEANYERVDFEANADVFVINTCTVTNTGDKKSRQI
    USA300_FPR3757  MSTVAFHTLGCKVNHYETEAIWQLFKEANYERVDFEANADVFVINTCTVTNTGDKKSRQI
                    ************************************************************

    COL             IRRAIRQNPDAVICVTGCYAQTSSAEIMEIPGVDVVVGTQDRHKLLGYIDEFRKERQPIN
    N315            IRRAIRQNPDAVICVTGCYAQTSSAEIMEIPGVDVVVGTQDRHKLLGYIDEFRKERQPIN
    NCTC8325        IRRAIRQNPDAVICVTGCYAQTSSAEIMEIPGVDVVVGTQDRHKLLGYIDEFRKERQPIN
    Newman          IRRAIRQNPDAVICVTGCYAQTSSAEIMEIPGVDVVVGTQDRHKLLGYIDEFRKERQPIN
    USA300_FPR3757  IRRAIRQNPDAVICVTGCYAQTSSAEIMEIPGVDVVVGTQDRHKLLGYIDEFRKERQPIN
                    ************************************************************

    COL             GVGNIMKNRKYEELDVPYFTDRTRASLKIQEGCNNFCTFCIIPWARGLMRSRDPEKVVEQ
    N315            GVGNIMKNRKYEELDVPYFTDRTRASLKIQEGCNNFCTFCIIPWARGLMRSRDPEKVVEQ
    NCTC8325        GVGNIMKNRKYEELDVPYFTDRTRASLKIQEGCNNFCTFCIIPWARGLMRSRDPEKVVEQ
    Newman          GVGNIMKNRKYEELDVPYFTDRTRASLKIQEGCNNFCTFCIIPWARGLMRSRDPEKVVEQ
    USA300_FPR3757  GVGNIMKNRKYEELDVPYFTDRTRASLKIQEGCNNFCTFCIIPWARGLMRSRDPEKVVEQ
                    ************************************************************

    COL             ATQLVNSGYKEIVLTGIHTGGYGQDLKDYNLAQLLRDLETINGLERIRISSIEASQLTDE
    N315            ATQLVNSGYKEIVLTGIHTGGYGQDLKDYNLAQLLRDLETINGLERIRISSIEASQLTDE
    NCTC8325        ATQLVNSGYKEIVLTGIHTGGYGQDLKDYNLAQLLRDLETINGLERIRISSIEASQLTDE
    Newman          ATQLVNSGYKEIVLTGIHTGGYGQDLKDYNLAQLLRDLETINGLERIRISSIEASQLTDE
    USA300_FPR3757  ATQLVNSGYKEIVLTGIHTGGYGQDLKDYNLAQLLRDLETINGLERIRISSIEASQLTDE
                    ************************************************************

    COL             VIDVLERSTKVVRHLHIPLQSGSDTVLKRMRRKYTMDRFSERLTKLHKALPDLAVTSDVI
    N315            VIDVLERSTKVVRHLHIPLQSGSDTVLKRMRRKYTMDRFSERLTKLHKALPDLAVTSDVI
    NCTC8325        VIDVLERSTKVVRHLHIPLQSGSDTVLKRMRRKYTMDRFSERLTKLHKALPDLAVTSDVI
    Newman          VIDVLERSTKVVRHLHIPLQSGSDTVLKRMRRKYTMDRFSERLTKLHKALPDLAVTSDVI
    USA300_FPR3757  VIDVLERSTKVVRHLHIPLQSGSDTVLKRMRRKYTMDRFSERLTKLHKALPDLAVTSDVI
                    ************************************************************

    COL             VGFPGETEAEFQETYDFIVKHKFSELHVFPYSPRIGTPAARMDDQIDEEIKNERVHKLIT
    N315            VGFPGETEAEFQETYDFIVKHKFSELHVFPYSPRIGTPAARMDDQIDEEIKNERVHKLIT
    NCTC8325        VGFPGETEAEFQETYDFIVKHKFSELHVFPYSPRIGTPAARMDDQIDEEIKNERVHKLIT
    Newman          VGFPGETEAEFQETYDFIVKHKFSELHVFPYSPRIGTPAARMDDQIDEEIKNERVHKLIT
    USA300_FPR3757  VGFPGETEAEFQETYDFIVKHKFSELHVFPYSPRIGTPAARMDDQIDEEIKNERVHKLIT
                    ************************************************************

    COL             LSNQLGKLYASKFDQDVLEVIPEEQGDTEGTLVGYADNYMKVQFEGDESLIGQIVKVKIT
    N315            LSNQLGKLYVSKFDQDVLEVIPEEQGDTEGTLVGYADNYMKVQFEGDESLIGQIVKVKIT
    NCTC8325        LSNQLGKLYASKFDQDVLEVIPEEQGDTEGTLVGYADNYMKVQFEGDESLIGQIVKVKIT
    Newman          LSNQLGKLYASKFDQDVLEVIPEEQGDTEGTLVGYADNYMKVQFEGDESLIGQIVKVKIT
    USA300_FPR3757  LSNQLGKLYASKFDQDVLEVIPEEQGDTEGTLVGYADNYMKVQFEGDESLIGQIVKVKIT
                    *********.**************************************************

    COL             QANYPLNEGQAIKVVDFATNKSDREVLV
    N315            QANYPLNEGQAIKVVDFATNKSDREVLV
    NCTC8325        QANYPLNEGQAIKVVDFATNKSDREVLV
    Newman          QANYPLNEGQAIKVVDFATNKSDREVLV
    USA300_FPR3757  QANYPLNEGQAIKVVDFATNKSDREVLV
                    ****************************