From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004160000
  • symbol?: rsmE
  • description?: 16S ribosomal RNA methyltransferase RsmE

      descriptions from strain specific annotations:

    • 16S ribosomal RNA methyltransferase RsmE
    • Ribosomal RNA small subunit methyltransferase E
    • RNA methyltransferase family protein
    • RsmE family RNA methyltransferase
    • protein YqeU
  • strand?: -
  • coordinates?: 4425487..4426149
  • synteny block?: BlockID0031900
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1535
    08BA02176:
    C248_1620
    11819-97:
    MS7_1594 (rsmE)
    71193:
    ST398NM01_1643
    ECT-R 2:
    ECTR2_1427
    ED133:
    SAOV_1577
    ED98:
    SAAV_1569
    HO 5096 0412:
    SAEMRSA15_14970
    JH1:
    SaurJH1_1669
    JH9:
    SaurJH9_1635
    JKD6008:
    SAA6008_01547 (rsmE)
    JKD6159:
    SAA6159_01512 (rsmE)
    LGA251:
    SARLGA251_14830
    M013:
    M013TW_1592
    MRSA252:
    SAR1654
    MSHR1132:
    SAMSHR1132_14170
    MSSA476:
    SAS1515
    Mu3:
    SAHV_1564
    Mu50:
    SAV1577
    MW2:
    MW1529
    RF122:
    SAB1449c
    ST398:
    SAPIG1643
    T0131:
    SAT0131_01673
    TCH60:
    HMPREF0772_11563
    TW20:
    SATW20_15730
    USA300_TCH1516:
    USA300HOU_1578
    VC40:
    SAVC_07135

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQRYFIDQNADVSQRFFITKKEDIHHITNVMRYDVGSKIILTFNDQTVYLCEIADITSDK
    N315            MQRYFIDQNADVSQRFFITKKEDIHHITNVMRYDVGSKIILTFNDQTVYLCEIADITSDK
    NCTC8325        MQRYFIDQNADVSQRFFITKKEDIHHITNVMRYDVGSKIILTFNDQTVYLCEIADITSDK
    Newman          MQRYFIDQNADVSQRFFITKKEDIHHITNVMRYDVGSKIILTFNDQTVYLCEIADITSDK
    USA300_FPR3757  MQRYFIDQNADVSQRFFITKKEDIHHITNVMRYDVGSKIILTFNDQTVYLCEIADITSDK
                    ************************************************************

    COL             IEVDLKEKQNINTELPVDVTICSGLIKADKYEWLLQKATELGASSFIAVSMERSIVKLNE
    N315            IAVDLKEKQNINTELPVDVTICSGLIKADKYEWLLQKATELGASSFIAVSMERSIVKLNE
    NCTC8325        IEVDLKEKQNINTELPVDVTICSGLIKADKYEWLLQKATELGASSFIAVSMERSIVKLNE
    Newman          IEVDLKEKQNINTELPVDVTICSGLIKADKYEWLLQKATELGASSFIAVSMERSIVKLNE
    USA300_FPR3757  IEVDLKEKQNINTELPVDVTICSGLIKADKYEWLLQKATELGASSFIAVSMERSIVKLNE
                    * **********************************************************

    COL             AKVAKKIERWQKIIKEAAEQSYRLVIPSIQFESNLKLICDTIDNYDYILIAYEEEAKDGE
    N315            AKVVKKIERWQKIIKEAAEQSYRLVIPSIQFESNLKLICDTIDNYDYILIAYEEEAKDGE
    NCTC8325        AKVAKKIERWQKIIKEAAEQSYRLVIPSIQFESNLKLICDTIDNYDYILIAYEEEAKDGE
    Newman          AKVAKKIERWQKIIKEAAEQSYRLVIPSIQFESNLKLICDTIDNYDYILIAYEEEAKDGE
    USA300_FPR3757  AKVAKKIERWQKIIKEAAEQSYRLVIPSIQFESNLKLICDTIDNYDYILIAYEEEAKDGE
                    ***.********************************************************

    COL             LSNFKQTLQQFNAQDKVLMIFGPEGGLSENEISLFSNTSTVVGLGPRILRAETAPLYALS
    N315            LSNFKQTLQQFKAQDKVLMIFGPEGGLSENEISLFSNTSTVVGLGPRILRAETAPLYALS
    NCTC8325        LSNFKQTLQQFNAQDKVLMIFGPEGGLSENEISLFSNTSTVVGLGPRILRAETAPLYALS
    Newman          LSNFKQTLQQFNAQDKVLMIFGPEGGLSENEISLFSNTSTVVGLGPRILRAETAPLYALS
    USA300_FPR3757  LSNFKQTLQQFNAQDKVLMIFGPEGGLSENEISLFSNTSTVVGLGPRILRAETAPLYALS
                    ***********:************************************************

    COL             AISYEKELMG
    N315            AISYEKELMG
    NCTC8325        AISYEKELMG
    Newman          AISYEKELMG
    USA300_FPR3757  AISYEKELMG
                    **********